SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013917 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013917
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 2.08e-31
Family SH2 domain 0.0000253
Further Details:      
 
Domain Number 2 Region: 149-215
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-21
Family SH3-domain 0.00046
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000281
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013917   Gene: ENSSHAG00000011903   Transcript: ENSSHAT00000014034
Sequence length 217
Comment pep:novel scaffold:DEVIL7.0:GL841483.1:924851:995013:-1 gene:ENSSHAG00000011903 transcript:ENSSHAT00000014034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVALYSFQATENDELAFNKGDTLKILNMEDDQNWYKAELHGAEGFIPKNYIQVKPHPW
FAGRISRQFAEEILLRRNHLGAFLIRESESSPGEFSVSVNYGNQVQHFKVLRENMGKYFL
WEEKFNSLNELVDFYRTTTIAKKKQIFLRDEDPTHKPPRAKFAKAQFDFAAQNSSQLSFS
QGDIIEVLEHSDPNWWRGQLCGRVGFFPRNYVHLVHM
Download sequence
Identical sequences G3WER2
ENSSHAP00000013917 ENSSHAP00000013917 XP_003761372.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]