SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014763 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014763
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily L domain-like 8.08e-49
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 2 Region: 208-362
Classification Level Classification E-value
Superfamily L domain-like 3.57e-24
Family Ngr ectodomain-like 0.03
Further Details:      
 
Domain Number 3 Region: 420-663
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.85e-18
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014763   Gene: ENSSHAG00000012606   Transcript: ENSSHAT00000014888
Sequence length 781
Comment pep:novel scaffold:DEVIL7.0:GL856776.1:1065012:1219726:1 gene:ENSSHAG00000012606 transcript:ENSSHAT00000014888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQNNQLSRIPAEALWELPNLQSLRLDANIISVVPERSFEGLSSLRHLWLDDNALPEIPI
RALNNLPSLQAMTLALNRIRLIPDYAFQNLSSLVVLHLHNNQIQHLGTNSFEGLHNLETL
DLNYNELLEFPVAIRTLGRLQELGFHNNNIKAIPEKAFVGNPLLQTIHFYDNPIQFVGRS
AFQYLPKLHTLSLNGATDIREFPDLKGTTSLEILTLTRAGIQLLPLGMCQQLPRLRVLEL
SHNQIEELPSLRRCQKLEEIPSGLQHNQMWEIGVDTFSQLTVLRALDLSWNVIRFIHPEA
FVTLHSLVKLDLTNNQLTTLPLAGLSGLVHLKLKGNPSLSEAFSKDSFPKLRVLEVPYAY
QCCAYRTCAGYFKASGQWEAEEGHLDEEEAMKRPPGLLGSHSESHYDLDLDEFQLEMEDS
KSHSSIQCSPSPGPFKPCEHLLESWGIRLAVWAIVLLSVLCNGLVLLAIFAGGPAPLSPV
KLVVGAIAGANTLTGISCGLLACVDTLTFGRFAQYGARWETGLGCRATGFLAVFASEASV
LLLTLAAVQCSISISCARAYGKSPSLGSVRAGALGCVVLGDYFDAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFREDLRR
LRPQAGVPGPLAYGAPDELEKSSCDSTQALVAFSDVDLVLEAPGVGHPPVLEAYGFPSVT
LVSCQQPGVPRLEGDHFLGPESGRLGGPQVHPTDGELLLGAEGGTPAGGFRPSLPAFASH
L
Download sequence
Identical sequences G3WH58
ENSSHAP00000014763 ENSSHAP00000014763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]