SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014807 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014807
Domain Number 1 Region: 3686-3828
Classification Level Classification E-value
Superfamily SET domain 1.27e-47
Family Histone lysine methyltransferases 0.0049
Further Details:      
 
Domain Number 2 Region: 1316-1386
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000132
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1416-1484
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000137
Family PHD domain 0.0085
Further Details:      
 
Domain Number 4 Region: 1553-1617
Classification Level Classification E-value
Superfamily Bromodomain 0.0000114
Family Bromodomain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014807   Gene: ENSSHAG00000012641   Transcript: ENSSHAT00000014932
Sequence length 3831
Comment pep:novel scaffold:DEVIL7.0:GL849657.1:1071870:1120596:-1 gene:ENSSHAG00000012641 transcript:ENSSHAT00000014932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQFLGFGSDEEVKVRSPTRSPSVKSSPRKPRGRPRSISERNSAVLSDSSPVFSPLSKPE
TKSGEKIKKKDSKSGEKRRGRPPTLSSVKFKLSQGKDISDLSKGSKEDTLKKIKRTPSAT
FQQAAKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSSERIKTDSTPLINSQ
LEKPQRVRKEKDGTPPLTKEEKAAVRQSPRRIKPVRIIPSTKRTDATIAKQLLQRAKKGA
QKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARL
ESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEMQALSEER
SNTPDVHAPLPISQSPENDNSDRRSRRFSISERSFGSRASKKLSALQSAPQQPTSSSPPP
PLLTPPPPLQPASSIPDHASWLMPPTIPLASPFLPASAAPIQEKRKSILREPTFRWTSLK
HSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTSGSTAPAQLFSALH
SGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSTGVSNRKRKRRVFSP
IRSEPRSPSHSMKTRSGRLSTSELSPLTPPSSVSSSLSISVSPLATSALNPTFAFPSHSL
TQSGESSEKNQRPRKQTSTPAEPFSSSSPTPLFPWFTQSSQTERGRNKDRATEELSKERD
VDKSMEKDKNRERDREREKENKRESRKEKRKKGSEIQSSSALFPIGRVSKEKVVEDIATS
SSAKKAAGRKKSSSLDPGSDIATVALGDTTAVKTKILVKKGKGSLDKTNLELAPAAPSLE
EKARCLSASSSSTVKHSTSSIGSMLAQADKLPVADKRVASLLRKAKAQLYKIEKSKTLKQ
ADQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKIL
SSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPE
DCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEK
KESNITKNLVDSSQKTTPPAREDHAPKKSSEPPPRKPVEEKSEDGNVSTAGTDSKQSSTS
ARKTGKQVSQPAQVIPPQPPSTAPLKKEAPKTTLSEPKKKQQPPPPPLPEQSKPKKVTPR
PSIPVKQKPKEKEKPPPVSKQENGTLNILNTLSNGNSSKQKLPADGVHRIRVDFKEDCEV
ENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQL
ENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCV
RCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKC
DRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTVRHPAEWRLALEKELQISLKQVLTAL
LNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPILTEVSKQEEQQPLDLEGV
KRKMDQGGYTSVLEFSDDIVKIIQAAINSDGGQPEVKKANSMVKSFFIRQMERVFPWFSV
KKSRFWEPNKVTSNSGMLPNAVLPPSLDHNYAQWQEREENNHTEQPPLMKKIIPAPKPKG
PGEPDSPIPLHPPTPPILRAQDTDRSREDSPELNPPPGVEDNRQCALCLTYGDDNANDAG
RLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEYCQKPGATVGCCLT
SCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVLRRVFVDFEGISLRR
KFLSGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYT
CKIVECRPPIVEPDINSTVEHDENRTIAHSPTSLTEIPPREIRNTAEIISPPSPDRPLHS
HTSSPCFYHVISKVPRLRMPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLR
SIGSRRHSTSSLSPQRSKFRIMSPMRAGNAYSRHSVSSISGIGAPADHDSNVKTIDHFLG
SLNPSTPNILGQNTPASSSSQRTLVTVGTKAGHMDGSPSSEMKHISAADLSTKSSSLKGD
KGKMLNSKGSEASTHVLTYPGHLKPATQVHNTTSGEVNVSKVGAFVEPSSVSFSSKEVLS
FPPLHLRGQKKERDQHTNSTQPENLSPGEDIETKALKAPGVNRSSIANEQVMSGFRDRRQ
KGKKSGKETFKEKHSSKSFLDPVTVMAGEEGNLKPEFVNQVLTSEHISQRSCNNISSEKS
GDKILPISGGSKVPSVQLEGPAKESQTPRKRTVKVTLTPLKMENESPSKNTLKEVVPVSP
SQGIESATLAESSSTLESPGDGSVTQPSPNDTASQESQSNTYPNLAVQDRNLMLQDGTKT
QEDSSYKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFFSSSSGKKRGKRSAEGQVD
GADDLSTSDEDDLYYYNFTRTVISSSGEERLGSHNLFREEEQCDIPKISQLDGVDDGTES
DTSVTTTTRKVSQLSKRNAKENGTENSLKLDRAEDSGEKEHVIKSSAGHKTNEPKIDNCH
PVSRVKTQGQDSLEAQLSSLESGRRVHTSTPSDKNLLDSYNTELLKSDSDNNNSDDCGNI
LPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLGLDSNRGKDMGLFEVFSQQLPTA
EPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPNRMAVISDTGEKRVTITE
KSVASTESDSSLLSPGVDPTPEGHMTPDHFIQGHMDTDHIASPPCGSVEQGHGNNQDLTR
NSSTPSLQVPVSPTVPLQNQKYVPSSTDSPGPSQISNAAVQTTPPHMKPATEKLLVVNQN
MQPLYVLQTLPNGVTQKIQLTPSVSSAPSVMESNTSVLGPMGSGLALATGLNPSLPASQS
LFPPSSKGLLPMTHHQHLHSFPAATQSSFPPNMNNPTSSLLIGVQPPPDPQLLVSETNQR
TDLNTTATTPPPGLKKRPISRLHSRKNKKLAPSSTSSSIAPSDMVSNMTLINFTPSQLSN
HPSLLDLGSLGNTTSHRTVPNIIKRSKSGIMYFEQAPLLPQSVGRAAASTVGTSTIGPDS
SHLTAGPVSGLASGSSVLNVVSMQATTAPTTGGSVPGHVLGQGSVTLTSPRLLGAPDIGS
ISNLLIKASQQSLGLQEQPMTLPPGSGMFPQLETSQPPSTAAMTSASSICVLPSTQTVGM
TVAPSSNEPEGSYQLQHMTQLLASKTGILPSQLDVASTSGSQLSSFPQLVDVPNNTGIEQ
NKASSSVMHASSASPGGSPSSGQQSASSSVLGPTKSRSKAKRIQLPLDKGSGKKHKVSHM
RTSSSEAHIPDPETNLASLTKVTGTPRSKSDVQDTANINQSSQKDFGQSTRQVTAIPEEL
PTQNSTNEQESAEPKVTEEEESNFSSPLMFWLQQEQKRKESIGEKKPKKGLVFEISSDDG
FQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLKMLGILHDAVVFLVEQLSGAK
HCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEE
EEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEY
AGNVIRSIQTDKREKYYESKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVI
NIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Download sequence
Identical sequences G3WHA2
ENSSHAP00000014807 ENSSHAP00000014807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]