SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014900 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014900
Domain Number 1 Region: 1866-2075
Classification Level Classification E-value
Superfamily SET domain 4.06e-72
Family Histone lysine methyltransferases 0.00071
Further Details:      
 
Domain Number 2 Region: 1749-1879
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-26
Family PWWP domain 0.0000241
Further Details:      
 
Domain Number 3 Region: 324-417
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000144
Family PWWP domain 0.017
Further Details:      
 
Domain Number 4 Region: 1700-1767
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000421
Family PHD domain 0.003
Further Details:      
 
Domain Number 5 Region: 2095-2166
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000332
Family PHD domain 0.0065
Further Details:      
 
Domain Number 6 Region: 1542-1591
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000131
Family PHD domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014900   Gene: ENSSHAG00000012712   Transcript: ENSSHAT00000015025
Sequence length 2703
Comment pep:novel scaffold:DEVIL7.0:GL834624.1:1086414:1219711:1 gene:ENSSHAG00000012712 transcript:ENSSHAT00000015025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQTCELPRRNCLQPFSNRVDLDAPEEKDTPFGNGQSNISEPLNGCAIQLSAAINSGTSK
ITYGQDPSSCYIPLRRLQDLASMINVEYLNGSTDGSESLQDPEKRDSRSGSPNVCTSLSP
SDPRALAMKQEPTCNDSPEFKVKITKTVKNGILHFDNFVCMEDADTDIESEMDTEQPGTE
DDSIDETFEKTRQDLTKTNATCNYQPQSENGIEVLMGIEQDSTTESCEIKSPVLPLAPNE
MQKNNQRTAMDSRIEKPELHPGPCSLGDTNITLEEQLNSINLSFQDDPDSSTSTLGNMIE
LPGTSSSSTSQELQFCQPKKKPAPLKYGVGQLVWAKFNRRPWWPSRICCDPLMNTHSKMK
VSSQRPYRQYYVEALGDPSEKAWVAGKSIVLFEGRHQFEELPVLRRRGKQKEKGYRHKVP
KKILSKWEASVGLAEQRDIPKDFKVRKRIRSSTKLDSEEDMPFEDCTNDPESEHERVLNG
CLKSLAFDSETSSDEKVKPCTKSRVRKRSTSLKRTSIKKSSMPFEAHNEERREKMTETLG
LNYVSGDVSDKQASTELCRIASSLTAASNTTTTNYLFSSRGKTTMKKEFETSNCDSLLGL
PESVLISSSSVERKKPLRSMVHSAKSPHLCYISAGDEEKRSDSASLWTTSDDESSDSDLD
PVDQSSESDESTLEISGSFDKDESELPLEKNEKLQYSRYHTKNTRVKARKKSIKTSSHLD
HLLDCTKTPDPGSEESQGADSDSKMPIIARNDNLSNKYTLPQNISHENAFVKSGLSNQPL
LQSKHNKQPKARSIKCKHKESPTAVDSSVLEEDFSLKCCSNDSKGSSVDCVVKSGKLDSL
KLLSNMHEKPRDSAEIETAVVKHVLSELKELSYRSLNDEISDSGSPKINKPLLFPSSSGQ
SRLPIEPNYKFSTLLMMLKDMHDSKTKEQQLMTTQNVVSYRNPGLGDCSSSSAAGGSKSL
VSGSLTHKAEKNGDCIQDSICQNPGGSESSLIREPSGSLTGLLTKKRRLTASGKRRANCI
TRRNCARSKSSKLQDDFLAQREKDIIESKDLKSEKKKKLNQLPSMTIETALSECKDVPDS
VNKSLSSRPADSKRKQSLQLMEHLTGEDCAHFSDVHFDSMVKKSDPDKNPEKCPSFENGE
VLELDSEMNSESSLSDESNDINHVAPKKRWQRFNQSRAKTSKRISRSRREKNSKSAFGGL
HPCDFLLEGNEGPENRPSSPSKVLEEEIKQNCEGRLDVVVPQLNVCDKPNSDGLHRESGL
SNFPPQPELSTQDARSEKKRLRRPSRWLLEYTEKYDQIFAPKKKQKKVQEQSKVSSPREN
EAQTTRCQSSTDLQNKPVEESSSTKEDPPVLEREAPFLERPIGQSELGGGNAELPELTLS
VPITPEVSSWSSLEPEESLLKPRNYESKRQRKPTKKLLESNDLDPGFMPKKGDLTLLRKC
YNTGPLENDISGSCTTLTSMDFGEGANKVFEKQRKRKRQRHVPAHCKKVRNEDSSREAQN
SEGEPVTSGTTSSPKDAIEESVEHDHGMPVSKKIQAERGGGAALKENVCQNCEKVGELLL
CEAQCCGAFHLECIGLTEMPKGKFICKECRTGIHTCFVCKTSGEDVKRCLLPLCGKFYHE
ACIQKYPPTVLQNKGFRCSLHMCITCHAANPASLSASKGRLMRCVRCPVAYHANDFCLAA
GSKVLASNSIICPNHFAPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNID
IPEGNWYCNDCKAGKKPHYREVVWVKVGRYRWWPAEICHPRAIPSNIDKMRHDVGEFPVL
FFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAVRFEELKAQKELRQL
QEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKASDDNPCGIDSECINRMLL
YECHPTVCPAGGRCQNQCFSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELID
EEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGD
TRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNHPNPTEEKSK
KLKRKQQVKRRSQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGKW
ECPWHQCDVCGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPGE
IREYVPPPVPLTSGANTQLAEQPSEIPAQRPLMVDKAPGAMGQRLQLSEKTLVGTCQRPQ
LSDKPLVMPDSTPQSPDKIPGVSGSRPQPLELGQRPADTSLVVTSPKPQLSDKPPLSGSK
SPPSVRSQLLDRPLVTSPRPQSLDKSLGSLSSKSQQLDRPVVTAGPRLQASDKSPVTNGP
KPQISDKPPTSDRPLAPLGQRLPSSEKVLSAVVQNLVSNEKALRPVDQNTRPKDRATMVI
ELSPRQKERATSPHEITPQPTEKLPVLEQSPWPVNKALGQMPRAAEKVHPSEPVLQASGR
ASAPVEHTWQAGKTLIQARLVPRPPAKGYLFEQAPRATGRAPVSMEQSSGSFGKALASGE
PMAGSPQPPGLATKATPLMVQSPRPPVKSPDLVPPAEKRSAVTEHPPWALGKSPAGPTPW
PAGADQPLAQTCRSPGSPQTLAQTCRPLDKGLIKGPDPKPEQSAVPALNQTPSSHEPAES
KEK
Download sequence
Identical sequences G3WHJ5
ENSSHAP00000014900 ENSSHAP00000014900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]