SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015022 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015022
Domain Number 1 Region: 993-1246
Classification Level Classification E-value
Superfamily SET domain 2.62e-82
Family Histone lysine methyltransferases 0.0000305
Further Details:      
 
Domain Number 2 Region: 727-968
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-71
Family Ankyrin repeat 0.0000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015022   Gene: ENSSHAG00000012820   Transcript: ENSSHAT00000015147
Sequence length 1286
Comment pep:novel scaffold:DEVIL7.0:GL834659.1:1111331:1315466:1 gene:ENSSHAG00000012820 transcript:ENSSHAT00000015147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTELLKDITNNKEEGGNAMAADESSTEKQGGEPQMAADGETNGSCERNEANSHPNPTKH
TQDNTKASPQEPANKLTRIAENGISERDSDFGKQNHVKASDFTQTSLTGSNGYILTKQTL
PEQPIRTTSTLASSLPGHAAKTLPGGANKGRTLSSFPHVQAATPTKLGEGSKDLDHKKPA
TTNPDVKVHRARKTMPKSIPSLHATSKDPREVRDSRDHKESKEESNKNVTEFGKQQLLPP
LSSLHQSLPQNQCYMATTKSQTAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSI
AHSTVGTKSEKDVGDSSLHVNGESLEIDSEEDDSDDLEEDEDHGSEQPPSFPVEDSRISK
ESISEIDRAQKMEDGESEEEQESGESGEEEEDGDESDLSSESSIKKKLLKRKGKIDSPWI
KPTRKRRRRNKKKPSSVLGTETYKSSLGSTGQAGQENSMDYMEVSLDSLDLRVKGILSSQ
SEGLSNGPEAVEIDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDNELGRCTNSVV
KYELMRPSNNVQLLVLCEDHRGKMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCA
SYVNNTSYCPHCGEETSKAKEVTIAKADTTSTVSLTYVQEKPATVEGRADTTTGSSKQSG
VGTQLSEEEKPESSTPQAPEGFELSGSSAFVKPTTGLSQGPVKETLESALIALDSEKPKK
LRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRTPLHAAAESGHVDICHMLIQ
AGANIDTCSEDQRTPLMEASENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDV
VQYLLSNGQMDVNCQDDGGWTPMIWATEYKHIDLVKLLLAKGSDINIRDNEENICLHWAA
FSGCVEIAEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRGSDVTLKNKEGET
PLQCSSLNSQVWGALQMNKNLRESSNEKPVQLEKTMSSRDIARGYERIPIPCVNAVDNEP
CPSNYKYVSQNCVTSPMNIDRNITHLQQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLP
EFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARLQLYRTQNMGWGVRSMQDIPLGTFV
CEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNISRFINHLCEPNLIPVRV
FMSHQDLRFPRIAFFSTRQIEAGEELGFDYGDRFWDIKGKFFSCQCGSPKCKHSSAALAQ
RQASSSQDTQENGLPDTSSAAAADPF
Download sequence
Identical sequences G3WHW7
ENSSHAP00000015022 ENSSHAP00000015022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]