SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016508 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016508
Domain Number 1 Region: 370-551
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.81e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 245-337
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000288
Family WWE domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016508   Gene: ENSSHAG00000014045   Transcript: ENSSHAT00000016646
Sequence length 551
Comment pep:novel scaffold:DEVIL7.0:GL861661.1:1382159:1400451:-1 gene:ENSSHAG00000014045 transcript:ENSSHAT00000016646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCLYRKQCKYNHSTDSLHNMTILKSHGIDNLNLNELCQLLLQNDSTLLPELCFLFWEGND
LSFFNCLYHSDSANFQMMISNPLKLDYNFSLVCEPSHSFQASPTTSLGVMGPVLDSLEAV
IALVLHLLILFLQAFINIQRVALLHIKTKVLHKPGYNYIMFFIVSLGYTIFLDKCFNVHF
HLPYRWQFFDGNTWKDLEEMENIEKEYCNPKSWQYFAKKPTSFLINFDNMSGGCYKVRRL
STASSVVKPPHFVFTTQWLWYWKSDGGLWQIYGLKGTERHVAAVNSTDIEKAYMSQESPI
LQFSIGKHNYELNFKAMTQKSLHFGTVRVVCRRPKYVSPEDLKMKQTWGDKLAAPKNVPS
HWDMSALPELGFKLIALSPSTGEYLKVQEQFCRTMPKYTIHKIERIQNPALWEVYQWQKA
QMKKSNGGQEVDERFLFHGTGPKYIEAICHQNFDWRICGLHGTSYGKGSYFARDAAYSHH
YCKSSVKPQPMFLARVLVGEFTRGSSSYLRPPAKEGQSNTFYNSCVNSLSDPSIFVIFEK
HQIYPEYLIWY
Download sequence
Identical sequences G3WM53
ENSSHAP00000016508 ENSSHAP00000016508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]