SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016651 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016651
Domain Number 1 Region: 52-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.04e-17
Family LIM domain 0.00092
Further Details:      
 
Domain Number 2 Region: 181-243
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.07e-17
Family LIM domain 0.0039
Further Details:      
 
Domain Number 3 Region: 109-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.83e-16
Family LIM domain 0.00052
Further Details:      
 
Domain Number 4 Region: 239-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000112
Family LIM domain 0.0011
Further Details:      
 
Domain Number 5 Region: 148-180
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000824
Family LIM domain 0.011
Further Details:      
 
Domain Number 6 Region: 21-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000824
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016651   Gene: ENSSHAG00000014165   Transcript: ENSSHAT00000016791
Sequence length 540
Comment pep:novel scaffold:DEVIL7.0:GL864871.1:1410277:1612736:-1 gene:ENSSHAG00000014165 transcript:ENSSHAT00000016791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEETVSQQQAVHSHLEKPSSTAILCNTCGNVCKGEVLRVQNKYFHIKCFVCKACGCDLA
EGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPP
GDRVTFNGKECICQKCSLPPSTSGSSYLLQGLRNCGGCGAEIKNGQSLVALDKHWHLGCF
KCKTCGKQLNAEYISKDGVPYCEADYHTKFGIRCDSCGKYITGRVLEAGEKHYHPSCALC
VRCSQMFAEGEEMYLQGTSIWHPACRQAAKTEEKNKETRTSSESIISVPASNTSGSPSRV
IYAKLGDEILDYRDLAALPKNKAIYNIDRPDMISYSPYISYSSGDRHSYGEGDQDDRSYK
QYRTSSPSSTGSVSYGRYTPTSRSPQHYSRPAGTLSLGTSSCISLPQHPSPTSMFRHHYI
PYFKGGSESGRSTPSLSMYSDSKPSPSTYQQAPRHFHVPDSGVKDNIYRKPPIYKQNVSK
KSDEDGNFDPDNRKQKTSWLFLKGDVDTRTNSPDLDTQSLSHSSGTERDSLQRMQGDFYS
Download sequence
Identical sequences G3WMJ6
ENSSHAP00000016651 ENSSHAP00000016651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]