SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018732 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018732
Domain Number 1 Region: 95-185
Classification Level Classification E-value
Superfamily WWE domain 1.96e-29
Family WWE domain 0.00095
Further Details:      
 
Domain Number 2 Region: 23-106
Classification Level Classification E-value
Superfamily WWE domain 1.96e-25
Family WWE domain 0.0013
Further Details:      
 
Domain Number 3 Region: 397-501
Classification Level Classification E-value
Superfamily RING/U-box 6.42e-20
Family RING finger domain, C3HC4 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018732   Gene: ENSSHAG00000015903   Transcript: ENSSHAT00000018887
Sequence length 626
Comment pep:novel scaffold:DEVIL7.0:GL841445.1:1954964:2019315:-1 gene:ENSSHAG00000015903 transcript:ENSSHAT00000018887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPGPGALISMNGLGFPPQNLARVVVWEWLNEYSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGSWTP
YDMDICITIQNAYEKQHPWLDLSSLGFGYVIYFNSMSQMNRQTQRKRRVRRRMDLAYPLT
IGSIPKSQSWPVGANSGQPCSCQQCLLVNSTRAASNAILASQRRKMYQASGTGTGTGTLP
VRQSNPFNGTGTTLWTGGTGPAGGAAKGEPGRSPGGVPGGNFSRSQSAPGGAQLPRQNNL
NRPGTQRVAVLSTRASIPPGVPALPVKNLNGTGPVHPALAGMTGILMCAAGLPVCLTRAP
KPILHPPPINKSDIKPVPGIPGICRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTIC
MERLVTASGYEGVLRHKGVRPELVGKLGKCGHMYHLLCLVAMYNNGNKDGSLQCPTCKAI
YGEKTGTQPPGKMEFHLIPHSLPGYTDTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPR
HCYLPDNEKGRKVLRLLIMAWDRRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHG
YPDPNYLDNVLAELTAQGVLEPSSKD
Download sequence
Identical sequences G3WTH7
ENSSHAP00000018732 ENSSHAP00000018732 XP_003761180.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]