SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021444 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021444
Domain Number 1 Region: 1658-2061
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.67e-102
Family Hect, E3 ligase catalytic domain 0.0000136
Further Details:      
 
Domain Number 2 Region: 487-784,901-1012
Classification Level Classification E-value
Superfamily ARM repeat 1.56e-40
Family Armadillo repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 810-877
Classification Level Classification E-value
Superfamily WWE domain 6.15e-22
Family WWE domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021444   Gene: ENSSHAG00000018173   Transcript: ENSSHAT00000021617
Sequence length 2068
Comment pep:novel scaffold:DEVIL7.0:GL849907.1:3316436:3434237:1 gene:ENSSHAG00000018173 transcript:ENSSHAT00000021617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSHLGQAKHKAYSPPESRKSISKAPKVQ
SNTTSEQSRGHISKRSCSSSSAVIVPQPEDPDRANTSEKQKTGQVPKKDSSRGVKRSASP
DYNRTNSPSSAKKPKALQHTEPSSETNKPHSKSKKRHLDQEQQLKSAPLPSTSKAHTRKG
GATGSSRSQKRKRTESSCIKSGSVSESTSAEERSAKPTKLASKSATSAKAGCSTITDSSS
SASTSSSSSAVASASSTVPQGARVKQGKDQNKARRSRSASSPSPRRSSREKEQSKTSGSS
KFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLASLRKPSKKRSESPPAELP
SLRRSTRQKTTGSCASTSRRGSGLGKRGAAEARRQEKMADPDSNQDGVNSSAARTDEPPQ
GAAASSSVAGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLGPRMSQLFHRTIG
SGASSKAQQLLQGLQATDESQQLQAVIEMCQLLVMGNEETLGGFPVKSVVPALITLLQME
HNFDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAEQALTALEMLSRR
HSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFVADSLPLLTQRLT
HQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNIQQLLVVTPPILSSGMFIMVV
RMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRSPQELYELTSLIC
ELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDSRIIEAAHQVGED
EISLSTLGRVYTIDFNSMQQINEDTGTARAIQRKPNPLANTNTSGYSELKKDDARAQLMK
EDPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVSS
HIASMLSSQDLKIVVGALQMAEILMQKLPDIFSVYFRREGVMHQVKNLAESETLLTSPPK
ACTNGSGTLGSSTTISTGTATAASNASADLGSPSLQHSRDDSLDLSPQGRLSDVLKRKRL
PKRGPRRPKYSPPRDDDKVDNQAKSPTTTTQSPKSSFLASLNPKTWGRLSAQSNSNNIEP
ARTAGVSGLARAASKDTISNNREKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQRLC
TATEQLNLQVDGGAECLVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSDKDAVSRDI
RIKRFLHVFFSSPLPGEEPIGRLEPMGNAPLLALVHKMNNCLSQMEQFPVKVHDFPSGNG
TGSSFSLNRGSQALKFFNTHQLKCQLQRHPDCANVKQWKGGPVKIDPLALVQAIERYLVV
RGYGRVREDDEDSDDDGSDEEIDESLAAQFLNSGNVRHRLQFYIGDHLLPYNMTVYQAVR
QFSIQAEEERESTDDESNPLGRAGIWTKTHTIWYKPVREDEDGSKDSVGGKRGRAQTAPT
KTSPRNAKKHDELWHDGVCPSVSNPLEVYLISSPPENITFEDPSLDVILLLRVLHAISRY
WYYLYDNAMCKEIIPTGEFNNSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPF
DTRQMLFYVTAFDRDRAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAES
VMQDLGSSRAMLEIQYENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLTNPKGSQ
EGTKYIQNLQGLFALPFGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYK
WMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLNMNG
CSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVARQFDSFRDG
FESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKYLFEILS
GFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLK
LPDYSSIEIMREKLLIAAREGQQSFHLS
Download sequence
Identical sequences G3X189
ENSSHAP00000021444 ENSSHAP00000021444 XP_012401970.1.9362 XP_012401971.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]