SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022046 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022046
Domain Number 1 Region: 76-182
Classification Level Classification E-value
Superfamily WWE domain 3.4e-33
Family WWE domain 0.00000119
Further Details:      
 
Domain Number 2 Region: 36-81
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000265
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022046   Gene: ENSSHAG00000018661   Transcript: ENSSHAT00000022222
Sequence length 353
Comment pep:novel scaffold:DEVIL7.0:GL856947.1:3897858:3898919:1 gene:ENSSHAG00000018661 transcript:ENSSHAT00000022222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMAGCGEIDHTINMLPTNRKANESCSNAGPSLTVPECAICLQTCVHPVSLPCKHVFCYLC
VKGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDER
TSRELEDAFSKGKKSTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAG
LRLDCDSTAVNLARESSADGADNISAQAGASVLPLVSTSVRPLTSLDGQLTSPATPSPDA
STSLEDSFTHLQISGDSVAERSHRGEGEEDHELLSSGRVPAPDTSVEETESDASSDSEDV
SAHLAQHLSSTQQRHLVPNVNQIATDRPTAGGGAVSASVRSRRPDGQCTVTEV
Download sequence
Identical sequences G3X2Z1
ENSSHAP00000022046 ENSSHAP00000022046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]