SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000536 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000536
Domain Number 1 Region: 60-131
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000119
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 2 Region: 120-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000653
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 163-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000042
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000734
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 7-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000536   Gene: ENSSHAG00000000479   Transcript: ENSSHAT00000000545
Sequence length 568
Comment pep:novel scaffold:DEVIL7.0:GL842317.1:1279:35047:1 gene:ENSSHAG00000000479 transcript:ENSSHAT00000000545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DENEYWMKSGNCENGHCINIVGSYRCECNEEFQSTSSGIDCVENRRGFCFAEVLHSMRHM
ASNCQSIVTKSECCCDEGWDWSGQCELCPFPVTTQYKKICPHGLGYATDERDGDEYKVMR
NLNNNGQCINTVGSFRCFCNVVYTADTSGTTCVDLDEYSPSLKPCNFVCKNTDGSYQYSC
PQGYILQEDGKTYRDLDKCQTKQHNCQFLCVSNLEGFNIHAHLDSHNLINTDCIGKKLTK
MMGICQRKKGRFASNCILLFEFSVETSHRNNSAIDECDANHKCQHIYQNTLGAYRCGCPQ
DYCQHYQWNQCVDENECTNPNACGSASSYNTFGSDKCTCPCGFSFDQFSSEYCDVNEYSS
ANNSCNYGCSNMEGGYLCGCTPGHYRVRQGHCVSEMGFNKGQYLEVDTQADEENTLSPEG
SKINGYSKKESRQNGNINKVEPTVVEKMDIESVDMDTPIKMKFNLSSLGNKLHILEGMPA
IESLNNHIQYIISQGNDNSIFRIDQQDELTYLHMAKKKSVPGTYTLEITSIPLYKKKEMK
KLEDSNEDNYLLGELGEALKMKLHIQLY
Download sequence
Identical sequences G3VBI2
ENSSHAP00000000536 ENSSHAP00000000536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]