SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001717 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001717
Domain Number 1 Region: 393-501
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-29
Family PDZ domain 0.0052
Further Details:      
 
Domain Number 2 Region: 144-241
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-26
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 3 Region: 2531-2620
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family Interleukin 16 0.003
Further Details:      
 
Domain Number 4 Region: 2400-2490
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family Interleukin 16 0.0019
Further Details:      
 
Domain Number 5 Region: 543-639
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-16
Family PDZ domain 0.016
Further Details:      
 
Domain Number 6 Region: 969-1050
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000158
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001717   Gene: ENSSHAG00000001530   Transcript: ENSSHAT00000001734
Sequence length 2624
Comment pep:novel scaffold:DEVIL7.0:GL841299.1:12593:172791:1 gene:ENSSHAG00000001530 transcript:ENSSHAT00000001734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLADQCWNGGFIYLIMLRRIKRKAPLPPSNGNNSNSCEPKATPTSEPSSRLVQNGKRTR
KFGVISRSSVSKDSGENRNSQDSELENGHCALMEMGGPRLETLEVSDRTDEQLPNTEVPL
VTGHYRPRLSEGKSDFKPSDHLTQREGCRIWKMHMVKGSDGLGIQITGGRGSKRSPHGII
VAHVEEGGAAHRDGRLTSGDELLMINGQSLVGLSHQEAVAILRAAAGLVQLVVASRENSE
VDFLKYPSTSLPDLLSTYSGPDASSYTDNKENEEPDAEEEKGASQSPNHGAMIDVDKSQD
PSCLEGSQGNCKSPTMGSCMMKCRSRSQGGAPRLESVGEDDELTVENGDSNVEILEKLSR
SARKHSLPQQLDSVGARQEYHIVKKSTRSLSTAQVESPWRLAQPSIISNIVLMKGQGKGL
GFSIVGGQDSARGRMGIFVKTIFPNGAAAADGRLKEGDEILEVNGESLQGLTHQEAIQTF
KQLKKGVVTLTVRTRLRSPSLTPCPTPTLMSRSSSPNSNTSGGTPAPGSDEGDSSSLGRK
GPGPKDRIVMEVTLNKELGVGLGIGACCLSLENSSPGIYIHSLAPGSVAKMDSRLSRGDQ
ILEADSVSLRHAALSEAYAILSECGPGPVSLIISRHPNPKINKRKYSLISRNATLHSSER
LSAVSTGTPLKSPSLTAKGSLSSESELSQYFSQDVLSPLSYSDSVVASSGDEEHMNQRRG
SSSLDDGILPPSSLTPKESGKARANSLASSGNKKASGPFHKHLEATRQASLPGSPQCARS
PLLRQRKIGCFDAEDASDEEEFVRDGDNVPFPRTLPGSFPSQTEEDPRVIIPNSSVATNS
SQEVEHFGNPATEAPLETSLLESSAGEVEDKASEHIRDSPLLPGKLFDYPGALEGNPSSL
GLKEQAESKKSPKLEHKAITRVKSLMSIECPGSPKQKNEDPGSAHKPVARITPQSKKAVT
EDNSRPSSLETVHLIRLEDESFGLDLEIQASPLKVVIKGLRPGGAAERESTGQLSVGDEI
VSFNGAPVNSLSYLEACQVIKNLPMALTLVGKQLPYTCFQPSNLCLLTLGKKNPYHPKKG
DLSMPLNQCSKSFRPTQTLNSAILKINFTKQMKLSREDSPKPTVDKFSKMFSQLYHGRPQ
FTARALLSPYFTPSSFSLSNQDHLESPREKELTNTDPSVTLAARETHPKVTQASETEGTM
QSGPILPSAVGTKEMQMGSELRVRGSEEMPVTDIDSIISELDTCEGGAERPPKAGAPCGD
RASQRHSWAKSRSSCQMEQSTVKQDSPQKINCGPSPPQPQWTSNFSVLDSINPGKHFTVN
KNCLSSYSRNFSSLHEASLSSLGHGETETTEPSPKSMYGAAEDSHSDPESLTEASSTPIR
GSTPSHPPSCSSQTYNAPESDEEQIEICCTNTHPKPLSLVEQRPSPVAKVSPLESTVMGG
LQTTPCATPSFGPETTMNPNSYQQVNAGRTVPLVSLPSSHLDKGTWESSACSDGNTPQGC
RALHTEGKMQEASTGKALETCESSRGSGLVHKPPIPFIGPRLINGLEHSLLDNKSQCKKQ
EATIKVVDSHRCTQFSLNPGSFTNEECDLTSLHISESQDLGDLRQGPEKTVRDLLLAQYK
DPSKINHSMQNRNEKEQCIAATKSSNTKTPTPSTNHVKGVTTLHSPSSQPKSNPETKGST
PKSFMETLLNNNHKLRSGPKLKGLSIKSKNKTSTEASAAIQTAKVSGTEQRKIFTSPQTS
PKTLSKKVLGARSIAVHGEPDKSCPTTPKSPTCRQESKLALAVSGPMSSPVLDGGIPITG
NTNENRFFGRNEFGLSNSKEASALPSGLGEKGSKAAAGDSRDRMNQVKIIAISSERNPQS
PGDDKLTESDQGGFSIQENSHKKCENKLCHKRGELPPSQPPLASHSIQEDPPEGQEIQRS
FIEVRLSSSSSSFLPVCPSPTLSVEKTAYNQKKTNQMSEPPGNSKNVITLNDSPYCSPRP
VTRTYSMPAQLASHFGGESHSRQSTGCSVQNSQNSVVNEKCACVPETRILKGGLLGLVNG
QGIQGEKQLSETSQSIQKIEQGGASALGTQETNCLITDRIRSNRRHYYYELNWPHEPTSS
FSVKQRIKSFENLASFDRPVVKSIDFPSAVSMNSKPPIGRRSSGTISSGTPSNLNDTSRS
LRRSLSSCGENQNDSISLAPQLNKSPSTMALLASPLNPVEDRRDGAGLNHKKFLDPPANY
NPSVTTASHIRRNRTAGGPARPCPLSRSKLRELRALSMPDLDKLCDEEYSVEPVAAHFKT
ELEIIPRRSLGLAPESLSNLDESSSLSHLVKEQSEDRLCSRGNSPWTSGSGTPASASDED
ITIQNNSVDKRCYGRSWSISLDQLSISCLDQQKLQSVLSSVGSKSDILSLIQEAKVQTEN
KEDIFFVVLNKESGSGLGFSVAGGVDLEQKSITVHRVFSQGVASQEGSIHRGDLLLSING
TSLAGSVHGDVLNALHQAKMHKDAVIVIKKVKAQERGTARQEPTSASGKMSMFKKDVNLE
PGIAGKQAELNDAVCVELLKTSAGLGFSLDGGKASVAGDRPLLIKRVFKGGTAEQAGTVE
AGDEILAINGKSLTGLMHYDAWNMIKSVPEGPVQLLIRKHRTAV
Download sequence
Identical sequences G3VEW3
ENSSHAP00000001717 ENSSHAP00000001717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]