SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002936 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002936
Domain Number 1 Region: 420-642
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-22
Family Tandem AAA-ATPase domain 0.0064
Further Details:      
 
Domain Number 2 Region: 32-130
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000594
Family Tudor domain 0.015
Further Details:      
 
Domain Number 3 Region: 915-1013
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000165
Family Tudor domain 0.0077
Further Details:      
 
Domain Number 4 Region: 574-766
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000085
Family Tandem AAA-ATPase domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002936   Gene: ENSSHAG00000002599   Transcript: ENSSHAT00000002969
Sequence length 1113
Comment pep:novel scaffold:DEVIL7.0:GL834644.1:36634:83295:-1 gene:ENSSHAG00000002599 transcript:ENSSHAT00000002969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLYIICLLLIEDPGCFWVIIKGCDNFLDHEMEYQKLNIQMNTFYNSIYKDVEKVKPLLLE
EGQACVVYCQELKCWCRAVIKSIMSSADHYLAECFLVDFAKYIPVKSKNIRVAVDAFMQL
PYRAKKFRLYCTKPVTLHIDFCEDNAEIVPAKKWDSAAIQYFQNILKATTQIEAKLCGME
EDIFDVYLYVTIKNEKVCVNDDLVAKNFACYVTPKEKKIDCPEKATPKSLESPPDKINPA
LALWPMLLQEKIPEKLEKRCSVVSSAFSQHCVGTRGAFLLGDFQPVPSKDQREILCNLSS
KKINEKIENIYKEKECISLKEINNITVAASAYCPRKGGITIYAEPDVRAERFSSSCQKFN
EKQFKLTLKKKYDEKNGCVKLLQFLNPDPLKTDGIHDMQQLQKSKSSIPQPSVVLRNKIE
PCSFETAPLSVDLKKILRKNKFLGPNHTESYCWPPIARGCDVVVISHHGNDPLLYIPPML
TFLQTGGCYKSLPSRSGPLAVIVCPGWKKAQHIFELLEEYGRCSRPLHPMLLIIGLNKEE
AQNTKFQRGCEVIITTPHSLLRLLKYHSLLFLRLCHLIFDEIEVLFFEAGEQMLTILDYF
KKTIIIEERESAPHQIVAVGAHWSKHIELLTKEFMNDPYIVITAMEEAALYGNVQQIVQL
CLDCEKTSTLLRMLDFSPSHAQKTLIFTSNVAEAEIVCKVVESSSIFCLKMHTEIAANFK
NVLEQWKKKLSLGSQIVLVLTDDCIPPLAITDATCVIHFSFPGSPKIFGGRLYCMSDNFQ
SLIEQGASSEQGNKRAKSVLLLTERSACCAVGVLRYLERTDAKIPPELCDFTAGVLEAKE
DKKLRRPLCHCLKVSGFCKDKRICPDRHHINPEIDMPRKLSDQNLSTTGYVKIIPFYIVN
ATNYFGRIVDKHKDLYAVLNMEMKEHFKESSNKMSVEKVEKFSLYGLYEKGVFHRFEVPS
LYTKEENCVFFNVHIKFIDEGRTSDTKNHQLLHLPQRFQNLPPQAVEFIVCRVKPIDNEI
EWNPKVTRYIHHKIIGKLHEAKVVLSLGNTVWVDPMVHLTKLSDLKTSVIEYNVRAEILS
MGMGTDNPEHIDQLKKLCQESKMVALQENTFQT
Download sequence
Identical sequences G3VID2
ENSSHAP00000002936 ENSSHAP00000002936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]