SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003101 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003101
Domain Number 1 Region: 23-254
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.63e-65
Family BAR domain 0.00037
Further Details:      
 
Domain Number 2 Region: 247-278,310-367
Classification Level Classification E-value
Superfamily SH3-domain 1.94e-17
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003101   Gene: ENSSHAG00000002748   Transcript: ENSSHAT00000003137
Sequence length 368
Comment pep:novel scaffold:DEVIL7.0:GL856745.1:40218:69829:-1 gene:ENSSHAG00000002748 transcript:ENSSHAT00000003137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSIEIHNFRQISIEGSLESSRIKQKQFTEEKLGQAEKTELDAHLENLLSKAECTKHWTEK
IMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRTNNQEVLGQYMIDAGNEFGPGTAYGNAL
IKCGETQKRIGMADRELIQTSAINFLTPLRNFIEGDYKTIAKEKKLLHNKRLDLDAAKTR
LKKAKMAEAKAISEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYY
AQCYQYMLDLQKQLGSFPSAFVSNNNQSSATSMSNASVSSSTAVTTSLLPSTSNTVITPT
VSDLKESSGSRKARVLYDYDAANSSELSLLADEVITVYSIVGMDSDWLMGERGNQKGKVP
ITYLELLN
Download sequence
Identical sequences G3VIU6
ENSSHAP00000003101 ENSSHAP00000003101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]