SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004173 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004173
Domain Number 1 Region: 317-377
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000943
Family Ran-binding domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004173   Gene: ENSSHAG00000003678   Transcript: ENSSHAT00000004214
Sequence length 381
Comment pep:novel scaffold:DEVIL7.0:GL841846.1:70852:111033:1 gene:ENSSHAG00000003678 transcript:ENSSHAT00000004214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQEMPQTMSQITNTSCALHGKSNNAQLGSSCECDLKRKTGYCQEKKFIAQPIFVFENRN
QAFKRPAEDTIDKVEHGFPGFSRKRVRSSSFTFHTADAMQESTPSQKRMRSSSFTVLPTF
PPSQPVKKNNVFMTTTALQWNVDFERTEKGPWEPSQQYPILRPAILPPPQSQRCAEWNEF
GHPRAVEFYKTNEKAKSEFSEENSHMASENSTSTQPLVKSSTGSTLLSPTPIKSQQNEDR
HSLQSHSSDFIFGENMNERVLSPQKSIELHQEKDVYNKEKPFSSTLSFSFHFSCTNSCKN
TTLKESAAAFSSKPSPKCILEKIEVITGEEEEHNVLKINCKLFIFKKITQSWTEKGRGTL
RLNDTANNNAGMLQSRLSKEN
Download sequence
Identical sequences G3VLW8
ENSSHAP00000004173 ENSSHAP00000004173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]