SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004882 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004882
Domain Number 1 Region: 20-126
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-33
Family MBT repeat 0.00042
Further Details:      
 
Domain Number 2 Region: 274-397
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.35e-29
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 381-456,484-520
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.69e-25
Family MBT repeat 0.002
Further Details:      
 
Domain Number 4 Region: 156-273
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.77e-23
Family MBT repeat 0.00018
Further Details:      
 
Domain Number 5 Region: 792-863
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.45e-17
Family SAM (sterile alpha motif) domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004882   Gene: ENSSHAG00000004280   Transcript: ENSSHAT00000004931
Sequence length 868
Comment pep:novel scaffold:DEVIL7.0:GL841616.1:108259:158817:1 gene:ENSSHAG00000004280 transcript:ENSSHAT00000004931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKGERRLSILDAGSGVEEVEFNWDEYLEDTGSIAAPHGSFKHVDTSLQNGFAPGMKLEVA
VKSDHETYWVATIITTCGQLLLLRYDGYGEDRKADFWCDIRTADLHPIGWCEQNKKILKA
PEGIKDKISDCYEFLRETLKGAYSAPSNLLEGLHKGKNPLDLIAPGSRLECQNFQDSLST
WIVNVADNIGGRLKLHYEGLENSDQFEQWLFYLDPFLHQVGWASQEGYALHPPTVIRHLK
SEAEWQEILTKIKEEEEESLIPSDLFKDKLVIGHHTFSVGMKLEALDPSAPFTISPATIV
KVFNEKYFLVEIDDLRAENTTRRSFVCHVNSSGIFPVHWSLKNGLHLSPPPGYPNQDFDW
ADYLKQCGAEAAPQSCFPLPISDHGFKENMKLEAVNPIDPEEVCVATITAVKGSYLWLQL
EGSKKPVPECIVSVESMNIFPVSWCETNGYQLRSPRRAVVNKQKKVAVVQPEKQIIPSRM
VHESLKNQEPNPPDSVTINGKYFCPKIYFNHRCFSGPYLNKGRIAELPQCVGPGNCVLVL
KEVLTLLINAAYKPSRVLRELQLDEDSVWHGHGETLKAKYKGKSYRATVEIVRTADRVTD
FCRKTCIKLECCPNLFGPQMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPPGGHSNLE
CVMKKTNKRRKRRKNFFVHKKKRSSTSVDNTPAGSPQGSGCEDDDDQDEVDEESLSEDSA
SEQQDELQEESEVSEKKSCSSSPTQSELSHSLAQERDKRKRKLRTFSFSDDENKPPSPKE
IKIEVAEKLQLDSNPLEWSVADVVRFIKSTDCAPLARIFLDQEIDGQALLLLTLPTVQEC
MDLKLGPAIKLCHHIERIKFAFYQQFAN
Download sequence
Identical sequences G3VNX7
ENSSHAP00000004882 ENSSHAP00000004882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]