SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005335 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005335
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-50
Family DBL homology domain (DH-domain) 0.0000000124
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.3e-44
Family Calponin-homology domain, CH-domain 0.0039
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 4e-33
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 4 Region: 632-752
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-25
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 5 Region: 782-840
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 6 Region: 582-665
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000019
Family SH3-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005335   Gene: ENSSHAG00000004661   Transcript: ENSSHAT00000005388
Sequence length 846
Comment pep:novel scaffold:DEVIL7.0:GL841414.1:115050:151185:1 gene:ENSSHAG00000004661 transcript:ENSSHAT00000005388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAHWLIQCRVLPPNHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAVNLREI
NLRPQMSQFLCLKNIRTFLAACCEKFGLRRNQLFEVFDLFDVQDFGKVIYTLSALSWTTI
AQNKGIMPFPTDEDNFGDDDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRT
EPAPMMPKMTELDKKACCLREIQQTEEKYTDTLSSIQQHFLKPLQRFLRPEDIEIIFINL
EDLLSVHSSFLRDLKEALSASGAAELYQVFISYKERFLVYGRYCSQVESASKHLDRVASM
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTTDALEKENMRLAL
DAMRDLAQCVNEVKRDNETLKQITTFQLSIENLTKNLAPYGRPKIDGELKIATSERRSKI
DRYAFLLDKALLICKRRGDIYDLKDFVNLPNYQVRDDSSGERDNKKWTHMFLLIEDQGTQ
GYELFFKTRELKKKWMEQFEMALSNIYPENATANGHDFQMFSFEETASCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHSSDHSTTMRKHKTSRSAPDKRKNELGLPKMEVC
QEYYGLPPPPVAFGPFLRLNPGDIVELTKAEAEQNWWQGRNTATNEVGWFPCKKVKPFVH
GPPQDLSVRLWYAGPMERAGAENILTNRSDGTFLVRQRVKDNAEFAISIKFNMEVKHIKI
LTAEGLYRITEKKAFRGLVELVEFYQQNSLKDCFKSLDTMLQFPFKEPERRAIARAPAAG
STRYFGSAKARYDFCARDRTELSLKEGDIIKIISKKGHQGWWRGEIYGRIGWFPSNYVEE
DYSEYC
Download sequence
Identical sequences G3VQ80
ENSSHAP00000005335 XP_012397527.1.9362 ENSSHAP00000005335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]