SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005805 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005805
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.6e-77
Family BAR domain 0.00000000197
Further Details:      
 
Domain Number 2 Region: 283-347
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005805   Gene: ENSSHAG00000005065   Transcript: ENSSHAT00000005859
Sequence length 352
Comment pep:novel scaffold:DEVIL7.0:GL841571.1:137175:188503:1 gene:ENSSHAG00000005065 transcript:ENSSHAT00000005859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTVSPLSSQLHIFLQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDECNFGPALGDVGEA
MRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQASQILQQVTVRL
EERIREASSQPRREYQPKPRMSLEFASGDNTQHNGGLSHTSTPKPTGVPMDQPCCRALYD
FEPENEGELGFKEGDVITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Download sequence
Identical sequences G3VRK0
ENSSHAP00000005805 ENSSHAP00000005805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]