SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006479 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006479
Domain Number 1 Region: 158-228
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.42e-25
Family PHD domain 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006479   Gene: ENSSHAG00000005638   Transcript: ENSSHAT00000006535
Sequence length 230
Comment pep:novel scaffold:DEVIL7.0:GL850020.1:170891:175186:1 gene:ENSSHAG00000005638 transcript:ENSSHAT00000006535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKNLSPEQRVEHLQKIQN
AYSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKEKMEGSDLESSGGRGLKK
GRGQKEKRGSRGRGRRTSEEDTPKKKKLKGGSEFAETILSVHPSDVLDMPVDPNEPTYCL
CHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Download sequence
Identical sequences G3VTH4
ENSSHAP00000006479 ENSSHAP00000006479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]