SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006603 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006603
Domain Number 1 Region: 39-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-47
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 489-585
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-18
Family PDZ domain 0.000021
Further Details:      
 
Domain Number 3 Region: 415-453
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000841
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006603   Gene: ENSSHAG00000005749   Transcript: ENSSHAT00000006661
Sequence length 706
Comment pep:novel scaffold:DEVIL7.0:GL861546.1:178645:219351:1 gene:ENSSHAG00000005749 transcript:ENSSHAT00000006661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGAEGLILPEFPLTGQFRYKRRVYTQSLLDDKQFAKLHTKANLKKFMEYVQLHSTEKVAR
LLDKGLDPNFHDPDTGECPLTLAAQMDSATDLLKVLRNGGAHLDFRTREGLTALHIATRC
RNPGALTTLLDLGASPDYKDSRGLTPLYHSALGGGDPLCCELLLHDHAQIGTADENGWQE
IHQACRFGHVQHLEHLLFYGADMRAQNASGNTALHICALYNQESCARVLLFRGASKDVRN
YNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYTKRRRLAGPSGLASPRPLQRS
ASDNDLKAEARSGPSPGPSLRSLPHQLLLQRLQEDKERDKDPTVHTLVRGGRSKSSSHSP
CSPCSPCSPCKPPSPCSPQDASAPPRGPGCCYLGEGPGARGVAVSGSVPGGWGGIHEKDS
LPVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDTRHETREDRTKRLFRHYTVGSYD
SLTSHSDYVIEDKVAVLQKREQEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDYEG
VAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLLMKVVSVTRKPEEEGARRRA
PPPPKRAPSTTLTLRSKSMTAELEELEKLDEILAAAAEPTLRPDIADADSRAATVKQRPT
SRRITPAEISSLFERQGLPGSEKLPGSLRKGIPRTKSVGMAMADSK
Download sequence
Identical sequences G3VTU8
ENSSHAP00000006603 ENSSHAP00000006603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]