SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000006700 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000006700
Domain Number 1 Region: 382-562
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.8e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 254-344
Classification Level Classification E-value
Superfamily WWE domain 9.03e-18
Family WWE domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000006700   Gene: ENSSHAG00000005831   Transcript: ENSSHAT00000006759
Sequence length 585
Comment pep:novel scaffold:DEVIL7.0:GL861661.1:184356:232535:-1 gene:ENSSHAG00000005831 transcript:ENSSHAT00000006759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRFSHDIHLPGNSKILKNNALFSINESELKVLLFQNDPFLWPEVCPYYNRGEGPHGSCNL
QDNCTKLHICKHFIWGECRFQKCKRSHNLHAENVMKLLREQGLNSSAILNIQRICKYKHS
EICKSFDKKSSNPLLSLPKYPADKRSEAAFINKKTKSDEICLYYIWKFCKRKNNCKNIHY
HLPYRWQKLDGTVWNDLPMMEGIEKLYCNPKNSSKVLCCTESFFLMGDLAINFETMTSGL
SPVRRLSTPSSVTKPASMVLTTTWIWYWVNDNGQWTEYGTQGESYPVSSITSVDIETVFL
ADSYSTIDFRAGHQYYEINFKEMFQRNLTSQTKRKVCRRPKFVSPEDVEKLRKGNLSFSG
MTLAIPPSWDKLAVPDIGYKVITVLCENSKEFSDVKNQFEKTMTGFIIQRILRIQNLALW
QVFQWQKEQMKKMNGGKDVDERRLFHGTKYIHLNDICSHNFDWRICGTHATVYGKGSYFA
RDASYSHNYSESETNVKIMFLARVLVGVFTQGDSKYVRPPMRQGTKNTFYDSCVNNRLDP
TIFVIFEKHQIYPEYVIEYTEKSKQCIISLNFSLLGLGTFFNYSQ
Download sequence
Identical sequences G3VU45
ENSSHAP00000006700 ENSSHAP00000006700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]