SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007006 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007006
Domain Number 1 Region: 202-474
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-78
Family Nuclear receptor ligand-binding domain 0.0000000021
Further Details:      
 
Domain Number 2 Region: 150-230
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-30
Family Nuclear receptor 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007006   Gene: ENSSHAG00000006089   Transcript: ENSSHAT00000007068
Sequence length 480
Comment pep:novel scaffold:DEVIL7.0:GL856875.1:203362:210016:-1 gene:ENSSHAG00000006089 transcript:ENSSHAT00000007068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGEQQAPEPEPGEAGRDGMGDSGRDCRSPDSSSLSSSPQPPPRGGPPPSPGPPLAPLPS
AASSLLGTGGPSQLPLGSPFPVISSSMGSPGLPPPAPPGPYGPVSSPQINSTVSLPGGGS
GTPEDVKPPLLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTI
RKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKEKDGEGEGAG
GAPEEMPVDRILEAELAVEQKSDQGVEGPGGAGGGGSSPNDPVTNICQAADKQLFTLVEW
AKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSISVRDGILLATGLHVHRNSAHSAGV
GAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLES
YCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences G3VV01
ENSSHAP00000007006 ENSSHAP00000007006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]