SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007244 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007244
Domain Number 1 Region: 295-424
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-26
Family Ran-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007244   Gene: ENSSHAG00000006295   Transcript: ENSSHAT00000007306
Sequence length 425
Comment pep:novel scaffold:DEVIL7.0:GL861544.1:218598:223728:1 gene:ENSSHAG00000006295 transcript:ENSSHAT00000007306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQCESGGAFKGFKGLVLPPGGGGGLSGFGNGTSIKTLEGLSNGSSMASVPTLALTKAAVE
KKVVFGRGTVNGPTASLGADKKAADLKTNGDSQQPSSSSSHSTQGKACSASAYHRQLAAL
NCSVRDWIVKHVDTNPLCDLTPIFKDYERYLTSIEQMPGNSSDSSSEREAGRQPFGTVPG
PAVLGPSQKAQDSPFLFHPDKAEGAAEKRTEASVEKKLTPALAAASAASFHFGRKVDSSA
LGPLGSGPMANFSFSPGNAGIFGKDVTQASPVSFSPKMPEGHTDATAGDSKGAEEEESEE
PPKVIVTEVKEEDAFYSKKCKLFYKKDNEFKEKGVGTLHLKPAANQKTQLLVRADTNLGN
ILLNVLVPPNMPCSRTGKNNVLIVCVPNPPINEKSATVPVTMLIRVKTTEDADELHKILQ
EKKEV
Download sequence
Identical sequences G3VVN9
ENSSHAP00000007244 ENSSHAP00000007244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]