SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008391 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008391
Domain Number 1 Region: 117-289
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-43
Family Nuclear receptor ligand-binding domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 48-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-31
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008391   Gene: ENSSHAG00000007273   Transcript: ENSSHAT00000008459
Sequence length 309
Comment pep:novel scaffold:DEVIL7.0:GL834671.1:301086:328699:1 gene:ENSSHAG00000007273 transcript:ENSSHAT00000008459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMADYSAALDPAYTTLEFENVQVLTMGNDASPSEGVNLNAPNSLGVSPMCAICGDRATG
KHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEA
VQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKKIANIADVCE
SMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDY
IVPRHCPELVEMSRVAVRILDELVQPFQELQIDDNEYACLKAIIFFDPGTGSQAEPPSSP
AWWNPVDEV
Download sequence
Identical sequences G3VYY6
ENSSHAP00000008391 ENSSHAP00000008391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]