SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008865 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008865
Domain Number 1 Region: 53-196
Classification Level Classification E-value
Superfamily PH domain-like 0.00000812
Family Phosphotyrosine-binding domain (PTB) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008865   Gene: ENSSHAG00000007675   Transcript: ENSSHAT00000008938
Sequence length 203
Comment pep:novel scaffold:DEVIL7.0:GL834688.1:342329:355121:1 gene:ENSSHAG00000007675 transcript:ENSSHAT00000008938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSDSNSDTC
AEFRIKYVGAIEKLKLTDGKNLEGPLDLINYIDVAQNSKQDGKLPFVPLEEEFIMGVSKY
GIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDTNYEEYSLWVYQCNSL
EQAQAICKVLATAFDSVLTSEKS
Download sequence
Identical sequences G3W0B0
ENSSHAP00000008865 ENSSHAP00000008865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]