SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008912 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008912
Domain Number 1 Region: 398-494
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.85e-22
Family PWWP domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008912   Gene: ENSSHAG00000007717   Transcript: ENSSHAT00000008986
Sequence length 505
Comment pep:novel scaffold:DEVIL7.0:GL834610.1:345789:347351:-1 gene:ENSSHAG00000007717 transcript:ENSSHAT00000008986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGPDDHSPIQPPEPSLAKSLWTSKPPPLFHEGAPYPPPLFIRDTYNQSIPQPPPRKIKR
PKRKMYREEPTSIMNAIKLRPRQVLCDKCKNSVVAEKKEIKKGGNATDSSKYDDNKKRRN
ESVTTVNKKLKTDHKMDGKNQNESQKRNAVVKVSNIAHSRGRVVKVSAQANTSKAQLNTK
KVLQSKNMDHAKAREVLKMAKEKAQKKQNETSTSKNAHSKVHFTRRFQNTSSGSLPPRLR
LKPQRYRNEENDSSLKAGLEKMRSGKMAPKPQSRCTSTRSAGEAPSENQNPSKGPEEANS
EVQTLGKKGSKSNITVYMTLNQKKSDSSSASVCSIDSTDDLKSSNSECSSTESFDFPPGS
MHAPSTSSTSSSSKEEKKLSNSLKMKVFSKNVSKCITPDGRTICVGDIVWAKIYGFPWWP
ARILTITVSRKDNGLLVRQEARISWFGSPTTSFLALSQLSPFLENFQSRFNKKRKGLYRK
AITEAAKAAKQLTPEVRALLTQFET
Download sequence
Identical sequences G3W0F7
ENSSHAP00000008912 ENSSHAP00000008912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]