SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008952 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008952
Domain Number 1 Region: 725-940
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-104
Family Thrombospondin C-terminal domain 0.0000000864
Further Details:      
 
Domain Number 2 Region: 598-723
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.1e-34
Family TSP type-3 repeat 0.00000357
Further Details:      
 
Domain Number 3 Region: 517-600
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.1e-18
Family TSP type-3 repeat 0.0000644
Further Details:      
 
Domain Number 4 Region: 226-271
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.00000000000000119
Family Assembly domain of cartilage oligomeric matrix protein 0.0018
Further Details:      
 
Domain Number 5 Region: 449-541
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000011
Family TSP type-3 repeat 0.00017
Further Details:      
 
Domain Number 6 Region: 317-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000954
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 53-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000103
Family Laminin G-like module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008952   Gene: ENSSHAG00000007756   Transcript: ENSSHAT00000009026
Sequence length 957
Comment pep:novel scaffold:DEVIL7.0:GL856822.1:350000:362325:-1 gene:ENSSHAG00000007756 transcript:ENSSHAT00000009026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELRGPLALLLLCSFASASQDLQVIDLLTMGESRQMVAMAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRRDNTRWLEASIVGKINKVLVRYQREDGKVHAVNLQQVGLADG
RTHTALLRLRGPSRPNPALQLYVDCKLGDQHAGLPPLAPIPPAEVDGLEVRTGQKAYMRM
QGFIESMKMILGGSMARVGALSECPFQGDEESIHNAVTGVLHSILGEQTKALVTQLTLFN
QILVELREDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYR
CGPCPPGLQGNGSHCADINECAHADPCFPGSKCINTMPGFHCETCPQGYKGTQVSGVGID
YARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRSGFLGNQSQGCLPARACQ
SPAHNPCHVHAHCLFERNGAVSCSCNIGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCK
QDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDAC
DNCPNVPNNDQKDTDSNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACD
SCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGQGDEC
DGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVADPLDVCPESA
EVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEG
TFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVKSVS
GPGEHLRNALWHTGHTPEQVRLLWTDPRNVGWQDKTSYRWQLLHRPQVGYIRVKLYEGPQ
LVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
Download sequence
Identical sequences G3W0J7
ENSSHAP00000008952 ENSSHAP00000008952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]