SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009029 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009029
Domain Number 1 Region: 305-366
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000288
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009029   Gene: ENSSHAG00000007818   Transcript: ENSSHAT00000009104
Sequence length 376
Comment pep:novel scaffold:DEVIL7.0:GL849765.1:356070:360234:1 gene:ENSSHAG00000007818 transcript:ENSSHAT00000009104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVAAWAAPRLGKHEPLLKPEYSPSYKRRRTVEDFNKFCTFVLAYAGYIPYPTEFGPSPSL
CFSSPCRLSEVFVPTRPEWSRAATKLRSLLSLRGQQKSFKMEFLPRGAIRPGPGKGLAQP
GSVLLLQEPPLRSSPSPANSTAGTIDSDSWDASFADLPSSVALPVADRCFGHLQPSLLQR
AKPSNFLMDRKKTDKLKKKKKRKRRDAEMPMEEEYMGGLLKLEPADTYAPRTASPDLQDI
PAASSDPCSGWDSDTRSSGSCAAATPEEVKEIQTEGKRTVIRQGKQVVFRDEDSTGNDED
IMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDS
KFDIRRSNRSRMGSRK
Download sequence
Identical sequences G3W0S4
ENSSHAP00000009029 ENSSHAP00000009029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]