SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009277 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009277
Domain Number 1 Region: 647-979
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.71e-63
Family DNA repair protein MutS, domain III 0.0011
Further Details:      
 
Domain Number 2 Region: 993-1239
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-51
Family ABC transporter ATPase domain-like 0.00000387
Further Details:      
 
Domain Number 3 Region: 306-432
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.57e-33
Family DNA repair protein MutS, domain I 0.001
Further Details:      
 
Domain Number 4 Region: 2-141
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.42e-27
Family PWWP domain 0.0088
Further Details:      
 
Domain Number 5 Region: 443-520
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.00000327
Family DNA repair protein MutS, domain II 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009277   Gene: ENSSHAG00000008029   Transcript: ENSSHAT00000009357
Sequence length 1274
Comment pep:novel scaffold:DEVIL7.0:GL834742.1:376771:389241:-1 gene:ENSSHAG00000008029 transcript:ENSSHAT00000009357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSCDFSPGDLVWAKMEGYPWWPCLVYNHPTEGTFIRERGKTFRVHVQFFDDNPVRGWVNK
RLVKPYTGSKCKEAQKGGPFYTAKPEILRAMQLADDAISIEKNKRLELAVCDEPSDPDEE
EMEVALASASDNSGEDLESEEEVRPKRQMAKRSTARNKKMRVVSDSESDIGGSDVEFKPD
TKEEGSSDEASSGMGESDSDMDSPVKAAPKRKRGTAVNSSLKRKSLGGCTSNVPKRVVGV
SSETKNTLNAFSAPQNFEAQAQVSGGGDGSCGSTQWYHETLEWLKEGKRKDACRRRPDHP
DYDPNTVHVPEDFLNTCTPGMRRWWQIKSQNFDLVIFYKVGKFYELYHMDAIIGVNELGL
VFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKLTHISRFDRVV
RREICRIITKGTQTYSVLDGEPSESNNKYLLCVKEKEEEASGHMRLYGVCFIDTSVGKFY
MGQFSDDRHCSRFRTLVAHYTPAQILFEKGNLSAETRKVLKVSLSSSIQESLTPGSQFWD
AAKTLRTLLEEGYFKEKLNVADGVVLPPVLKSMTSESDSIGLTPNEKSELALSALGGCVF
YLKKCLIDYELLSMANFEEYIPVDADMVKAVKPGAIFGKRDCRMVLDAVTLSNLEILQNA
VNGSTEGTLLERIDSCCTPFGKRLLKQWLCAPLCNPSSINDRLDAMEDLMAVPDKISEVV
DLLKKLPDLERLLNKIHSVGSPLKSQKHPDSRAIMYEETTYSKKKIVDFLSALEGFKVMC
KIVGIMEEVVGNFKSKILKQVITLRTQNSGGRFPELTTELNRWDTAFDHEKARKTGIITP
KTGFDSDYDQALVDIKDNEQSLLDYLEKQRKRIGCRSIVYWGVGKNRYQLEIPESFTLHD
LPGEYELKSTKKGCKRYWTKDIEKKLADLMNAEERRDVSLKDCMRRLFFNFDKNYRDWQT
AVECIAVFDVLLCLANYSRGGEGPMCRPVILVPDEETRPFLKLKGSRHPCVTNNFFGDDF
IPNDIMIGCKEEDSEDSTWDAYCVLVTGPNMGGKSTLMRQAGLLLIMAQMGCYVPAEVCS
FTPVDRVFTRLGASDRIMSGESTFFVEMNETASILQHATEHSLVLMDELGRGTATFDGTA
IANAVVKELAETIKCRTLFSTHYHSLVEDYSQNVAVCLGHMACMVENECEDPSQETITFL
YKFTKGACPKSYGFNAARLACLPEEIIQKGHRKAKEFEKMTQSLRLFREVCLALENSAAD
VQAIHKLLTLIKEI
Download sequence
Identical sequences G3W1H2
ENSSHAP00000009277 ENSSHAP00000009277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]