SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010374 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010374
Domain Number 1 Region: 145-457
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-99
Family Protein kinases, catalytic subunit 0.0000000000491
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-24
Family Pleckstrin-homology domain (PH domain) 0.000000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010374   Gene: ENSSHAG00000008957   Transcript: ENSSHAT00000010465
Sequence length 480
Comment pep:novel scaffold:DEVIL7.0:GL834582.1:486365:617886:1 gene:ENSSHAG00000008957 transcript:ENSSHAT00000010465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQMVADSLKKQEEELMDF
RSGSPSDNSGAEEMEVSTTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPDAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDNERRPHFPQFSYSASGTA
Download sequence
Identical sequences G3W4L9
ENSSHAP00000010374 ENSSHAP00000010374 XP_012405501.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]