SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000011546 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000011546
Domain Number 1 Region: 528-635
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-19
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 340-456
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000157
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 3 Region: 165-288
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000275
Family Spermadhesin, CUB domain 0.0071
Further Details:      
 
Domain Number 4 Region: 286-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000354
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 640-698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 700-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000337
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 767-826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000275
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 461-526
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000197
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000011546   Gene: ENSSHAG00000009922   Transcript: ENSSHAT00000011642
Sequence length 920
Comment pep:novel scaffold:DEVIL7.0:GL841556.1:609188:622853:-1 gene:ENSSHAG00000009922 transcript:ENSSHAT00000011642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPGAGLLPPPLLLLLLSCPWTCGVPLMEEESLAGESSESPTILPAALAELLHGALLKR
GPEMGDIPGSFLIPTLAADTEDQTLAPPSPPWVTEPGTGPLTTAVTPKGARGAGPTAPEL
LTPPPGTTAPPPPGPASPGPPLGSEGGEEETTTTLITTTTVTTVTSPVLCNNNVSEGEGY
VESPEFGRSAAPTLGPLDCTYSISVYPGYGIEIQVQSLNLSREEGLLVLAVSGAPAPATQ
LLANASLLGEGQVLRSPTNRLLLHFRSPRTPRGGGFRIHYQAYLLSCGFPPRPPHGDVSV
TDLHPGGTATFHCDSGYQLQGEDTLVCLNATRPAWSGEPPACLAACGGSIHNATLGRIVS
PEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLVVRSGGGPLSPLIYDSDMD
DVPERGLISDAQSLYVELLSETPANPLLLSLRYEAFEEDRCFAPFLAHGNVTSTDPQFRP
GALATFSCLPGYALEPPGPPSAIECIDPSDPHWNDTEPACKAMCGGELSESAGVVLSPDW
PQSYSPGQDCVWGLHVQEEKRILLQVEILNVRGGDMLTLFDGDSPSARVLAQLRGPQPRR
RLLSSGPDLTLQFQAPAGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLI
RGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEISNGHRTASDAGF
PIGSHIQYRCLPGYSLEGAAVLTCYNRDTGTPKWSDRVPKCVLKYEPCLNPGVPENGYQT
LYKHHYQAGESLRFFCYEGFELIGEVTITCLPGHPSQWTSQPPLCKVAYEELLDDRKLEV
TQTTDPSRQMEGGNLALAILLPLGLVILLIGGVYLYYTKLQGKSLFGFSGSHSYSPITVE
SDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences G3W7Z1
ENSSHAP00000011546 XP_003762106.1.9362 ENSSHAP00000011546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]