SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012297 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012297
Domain Number 1 Region: 156-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-75
Family Nuclear receptor ligand-binding domain 0.00000000163
Further Details:      
 
Domain Number 2 Region: 106-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012297   Gene: ENSSHAG00000010535   Transcript: ENSSHAT00000012396
Sequence length 440
Comment pep:novel scaffold:DEVIL7.0:GL856786.1:702252:1016098:-1 gene:ENSSHAG00000010535 transcript:ENSSHAT00000012396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCRMSSKDRHIDSSCSSYIKTEPSSPASLTDSINHHSPGGSSDASGSYSSTMNGHQNGL
DSPPLYPSAPVLGGNGPVRKRYDDCSSTIAEDSQTKCEYMLNSMPKRLCLVCGDIASGYH
YGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEVGV
RLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVP
DSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSL
SFEDELVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSD
SMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNI
KLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences G3WA42
ENSSHAP00000012297 ENSSHAP00000012297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]