SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012454 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012454
Domain Number 1 Region: 80-158
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000029
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012454   Gene: ENSSHAG00000010666   Transcript: ENSSHAT00000012556
Sequence length 160
Comment pep:novel scaffold:DEVIL7.0:GL849616.1:726533:951576:1 gene:ENSSHAG00000010666 transcript:ENSSHAT00000012556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSSTNSDTSAEKRNSSNQSTGAVQMRIKNANSHHDRLSQSKSMILTDIGKVTEPISRHR
RNHSQHLLKDVITPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRKIEFYKES
KQQALSNLKTGNKPECLDLCGAQIEWTKEKSSRKNVFQKT
Download sequence
Identical sequences G3WAJ9
ENSSHAP00000012454 ENSSHAP00000012454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]