SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012743 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012743
Domain Number 1 Region: 13-255
Classification Level Classification E-value
Superfamily SET domain 8.5e-65
Family Histone lysine methyltransferases 0.000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012743   Gene: ENSSHAG00000010905   Transcript: ENSSHAT00000012847
Sequence length 299
Comment pep:novel scaffold:DEVIL7.0:GL841594.1:766570:778267:1 gene:ENSSHAG00000010905 transcript:ENSSHAT00000012847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEQPGASLGGQRDVGRGLENLPVSSWPEGEEPEFQYTPEHVIGPGAEVDPTQITFPGC
TCLTTSCLPTICSCLLHGENYDNLCLRDIEGKMEFARPVFECNVMCQCSEQCKNRVVQRG
LQFNLQVFKTDKKGWGLRTLEFIPKGRFVCEYAGEILGSSEARRRIQQQTKHDSNYIIAI
REHICDGQIIETFVDPTNIGNIGRFLNHSCEPNLLMIPVRVDSMVPRLALFAAKDILPKE
ELSYDYSGRFRNFTKNDRNQEIPDKDKMGKPCYCATKSCAAFLPYDSSLYSPLEKQTTN
Download sequence
Identical sequences G3WBD8
ENSSHAP00000012743 XP_003762434.1.9362 ENSSHAP00000012743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]