SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012788 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012788
Domain Number 1 Region: 149-485
Classification Level Classification E-value
Superfamily Subtilisin-like 5.37e-89
Family Subtilases 0.0000000291
Further Details:      
 
Domain Number 2 Region: 480-625
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.4e-34
Family Proprotein convertase P-domain 0.00067
Further Details:      
 
Domain Number 3 Region: 75-139
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000051
Family Prohormone convertase 1 pro-domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012788   Gene: ENSSHAG00000010944   Transcript: ENSSHAT00000012893
Sequence length 795
Comment pep:novel scaffold:DEVIL7.0:GL849658.1:773226:800935:1 gene:ENSSHAG00000010944 transcript:ENSSHAT00000012893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRHKVQPWSAVLEPSLSLPACLWLIGTGFFLLVPLVTTLELTETIGPEVQSPRGLSW
AVLLDRLEGENKQESEEQRADALAQAAGLLNAGRIGELQGHYLFIQPPGHPGVQQEEAAR
RQAEAVLSGHKAVRWHSEQRLLKRAKRSVLFNDPKYPQQWHLNNRRIRGRDINVTGVWER
NVTGRGVTVVVVDDGVEHTIQDIEPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAG
EIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSLEAVAFNKHYQINDIYSCSWGPDDDG
KTVDGPHQLGKAALQHGVIAGRRGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAV
DEEGRMPFYAEECASMLAVTFSGGDKLLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAG
MIALMLQVRPCLTWRDVQHIIVFTATRYEDRRADWNTNEAGFSHSHQHGFGLLNAWRLVN
AAKIWTSVPYLASYISPILKENKRIPVSPHSLEVLWNVSKSDLEMSGLRTLEHVAVTVSI
THPCRGSLELKLFCPSGMMSLIGAPRTLDKDPSGFNDWTFSTVRCWGERAQGTYKLVIRD
VGDEPLQAGALQQWQLMLYGSVWSPADIRERQRQLEDAMSGKYLHDGFSLPCPPGLDIPE
DEGYTMSPNTLKTLLLLGCFAVFWTFYYLLEVYLSQRDVTFDLACTGGHCWWLQRGRKAL
EEGTELESVPLYHGKDTGEADTETEDYPPSSGLQAPDLLDQSNWDLVQGRDRFPELAHQN
LQPDLLHREQEQQVC
Download sequence
Identical sequences G3WBI3
XP_003764243.1.9362 ENSSHAP00000012788 ENSSHAP00000012788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]