SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012829 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012829
Domain Number 1 Region: 373-551
Classification Level Classification E-value
Superfamily SPOC domain-like 3.06e-48
Family SPOC domain 0.00037
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.74e-30
Family Canonical RBD 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012829   Gene: ENSSHAG00000010976   Transcript: ENSSHAT00000012934
Sequence length 553
Comment pep:novel scaffold:DEVIL7.0:GL841619.1:778313:779974:-1 gene:ENSSHAG00000010976 transcript:ENSSHAT00000012934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVVGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTI
DHVKGDSFAYIQYESLDAAQAACVQMRGFPLGGPDRRLRVDFAKAEETRYPQQCQAAPLP
VHYELLPEGYSRHRNLEADLRVRDRTPPHLLYSDRDRSFVESDWASPSKSTDRRNSLESY
GRSVRSRSGERWGSEGDRSLPKPWEERRKRRSLSSDHGRTAHSPYEERGRTKASGPPSDR
SPERPRRENHTSEPGPEKEPSNSLPNNRHGAEERGPDSHQGKKRDSERNHRTSEVEAKPA
PEEPKPETKKLKSLSEYAQTLQLGWNGLLVLKNSCFPTCMHILEGDLGVISGLLKDHASG
SKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYVVLLATQASPGGPGAEGTHAVEPGLQ
RRLLRNLVSYLKQKQAAGVISLPVGGTKGRDNTGMLYAFPPCEFSQQYLQSALRTLGKLE
EEHMVIVIVRDTA
Download sequence
Identical sequences G3WBM4
ENSSHAP00000012829 ENSSHAP00000012829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]