SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012906 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012906
Domain Number 1 Region: 364-604
Classification Level Classification E-value
Superfamily RNI-like 2.16e-28
Family Cyclin A/CDK2-associated p19, Skp2 0.032
Further Details:      
 
Domain Number 2 Region: 73-135
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000015
Family PHD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012906   Gene: ENSSHAG00000011039   Transcript: ENSSHAT00000013012
Sequence length 617
Comment pep:novel scaffold:DEVIL7.0:GL867613.1:788261:790183:1 gene:ENSSHAG00000011039 transcript:ENSSHAT00000013012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSPRLPPPVRPTPSPPVSGARRRRVRCRKCEACVQGECGVCRYCRDMKKFGGPGRMKQ
SCVLRQCLAPRLPYSVTCSLCGEVDQNEETQDFEKKLMECCICNEVVHPGCLQMDGEGLL
NDELPNCWECPKCFQPDDSEKVQRRKMDDGEEGVVQAKVLRPLRSRDEPLVQQPPHSSAT
AMLQLIHDPGPPHGMVTRSSPGASPSDHHGAGRDDRFKRRQLRLQATQREKENNPSGKKE
LSEVEKVRIRGTYLMVTPQRPNKELQGTSIVPKLQAITASSANFHHSPRVLVQHCPALTP
QLRDEDDLGRGPEEESAPEEEEESTEEVEAVAVNHEDSFTQDEEESWMQREIWLAVFRYL
NRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNIS
KKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLSP
PTDKPGNDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSYLTDQSPNLL
TAVGSSTRNSLTEINMAGCNKLTDQSLLYLRRISNVTLIDLRGCKQITRKACEHFISDLS
INNLYCLSDEKLIQKIS
Download sequence
Identical sequences G3WBV1
ENSSHAP00000012906 ENSSHAP00000012906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]