SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013664 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013664
Domain Number 1 Region: 218-491
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.8e-79
Family Mitochondrial carrier 0.0000709
Further Details:      
 
Domain Number 2 Region: 41-193
Classification Level Classification E-value
Superfamily EF-hand 1.57e-34
Family Calmodulin-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013664   Gene: ENSSHAG00000011678   Transcript: ENSSHAT00000013776
Sequence length 500
Comment pep:novel scaffold:DEVIL7.0:GL841413.1:887916:896286:-1 gene:ENSSHAG00000011678 transcript:ENSSHAT00000013776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGRAVIASAPARPGPAGCALGGSHGTAMARTSPGHSPPAGDPERQQRWGLLFDELDSNKD
GRVDIHELRLGLARLGARTPDSAGQDILQEGDIDQDGGLTLEEFTRYLQEHERRLLLMFH
SLDRNQDGHIDASEIQQSFQALGVSISLQQAEKILHSMDRDGTMTIDWQEWRDHFLLQPL
ENMEDVLKFWKHSTVLDIGECLTVPDEFSEQEKLSGMWWKQLVAGAVAGAVSRTGTAPLD
RLKVFMQVHASKTNQLNVLGGLRSMVQEGGIRSLWRGNGINVLKIAPESAIKFMAYEQIK
WAIRGQQETLRVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRQTGQYKGLLDCARQILE
QEGPRAFYKGYLPNVLGIIPYAGIDLAVYETLKNRWLQQDSHHSADPGILILLACGTISS
TCGQIASYPLALVRTRMQAQASVEGAPQLTMLGLFRHILSREGVWGLYRGIAPNFMKVIP
AVSISYVVYENMKQALGVTT
Download sequence
Identical sequences G3WE09
ENSSHAP00000013664 ENSSHAP00000013664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]