SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014443 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014443
Domain Number 1 Region: 252-478
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-64
Family Nuclear receptor ligand-binding domain 0.00000000196
Further Details:      
 
Domain Number 2 Region: 132-215
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.17e-28
Family Nuclear receptor 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014443   Gene: ENSSHAG00000012333   Transcript: ENSSHAT00000014564
Sequence length 480
Comment pep:novel scaffold:DEVIL7.0:GL861600.1:1012725:1064683:1 gene:ENSSHAG00000012333 transcript:ENSSHAT00000014564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQGLETLVHDSPRDSPSSGIGEMFGLKTTKGVLPEQSGHLGPDADVLPYTQYGNIQ
FSQVQPQISSSPYYPNLGFYPQQPEEWYSPGMYELRRVPSETVYTRESEIVDIPMTKKPR
MISSAGRMKGEELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCEMDM
YMRRKCQECRLRKCKQMGMLAECLLTEIQCKSKRLRKNVKPSSDRSGNEDNEGSDLRQVT
STTKSYREKIELTPDQQNLLHYIMDAYRKQRMPQEITNKILKEEFSAEENFLILTEMATS
HVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPVGHTDLLEERIR
KSGISDEYITPMFNFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDRDSVERLQEPLLE
ILQKLCKMYQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQC
Download sequence
Identical sequences G3WG88
ENSSHAP00000014443 ENSSHAP00000014443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]