SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014809 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014809
Domain Number 1 Region: 391-650
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-63
Family Nuclear receptor ligand-binding domain 0.00000000233
Further Details:      
 
Domain Number 2 Region: 319-396
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-27
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014809   Gene: ENSSHAG00000012643   Transcript: ENSSHAT00000014934
Sequence length 652
Comment pep:novel scaffold:DEVIL7.0:GL861721.1:1072289:1077963:1 gene:ENSSHAG00000012643 transcript:ENSSHAT00000014934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLCHFSIRLGYGLGVSNLHPPCPPQSLDTLILALAAWGYLYRAHLSNSRTTEMPCLPAQ
YGTSTQSPGPRDHFAIDPLIQSGFTKITMDLAGPEVPPTAPTALPSFSTFMDSYTGEFDT
FLYQLPGTTQPASSSSSSSSSTSSSSSSTSSSSATSPASSSFKFEDFQIYGCYPGSFSNQ
LDETLSSSGSDYYGSPCSAPSPSTPGFQPPQLSPWDGSSFGPFSPGQTYDSLRAWTEQLP
KGRPQPPAFFSFSPPAAPSPTLSPSPLKLLPPQPTHRLREGEGYGQAVFSALAPGSPHLD
GPLSPAKARAGVPGGTEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK
DCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQTPDSSPVNLLTS
LVRAHIDSVPSTAKLDYSKFQELALPQFGKEDPGDVQQFYDLLSGSMDVIRKWAEKIPGF
LDLPPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCTGLVLHRLQCLRGFGDWIDSIL
AFSRSLHSMVIDVPAFSCLAALVIITDRHGLQEPRKVEELQNQIAGCLKEHVSSSTSGEP
QSPSCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIVDKIFMDTLPF
Download sequence
Identical sequences G3WHA4
ENSSHAP00000014809 ENSSHAP00000014809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]