SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014836 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014836
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000176
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014836   Gene: ENSSHAG00000012665   Transcript: ENSSHAT00000014961
Sequence length 611
Comment pep:novel scaffold:DEVIL7.0:GL856822.1:1077798:1094932:-1 gene:ENSSHAG00000012665 transcript:ENSSHAT00000014961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSAAHPGGGGRRSKWDQPAPAPLLFLPPAAPGGEIPNSGGSSGGSAAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNAVEKLQVAGKGLVSSKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTAEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPVAQLSPAIGQKPPFQSGLHYVQDKLFVGLE
HAVPTFNVKEKVEGPSCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAINSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPGIVPPAVSLAPGVLPTLPTGVPPVPTQYPISQVQPPAST
GQSPMSGPFLPAAPVKTALPTSPQPQPQLPAQPQGQKRRFTEELPDERESGLLGYQHGPI
HMTNLGTGFSSQSEIEGAGSKPASSSGKEKERDSRQLMPPPAFPVTGIKTESDERNGSGA
LSGSHDYPAKKMKTTEKGFGLVAYAGDSSDEEEEHGGHKNASTFPQGWSLGYQYPSSQHR
AKQQMPFWMAP
Download sequence
Identical sequences G3WHD1
ENSSHAP00000014836 ENSSHAP00000014836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]