SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014857 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014857
Domain Number 1 Region: 101-219
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-47
Family MBT repeat 0.0000558
Further Details:      
 
Domain Number 2 Region: 205-334
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1e-38
Family MBT repeat 0.0000387
Further Details:      
 
Domain Number 3 Region: 1-93
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-31
Family MBT repeat 0.0000291
Further Details:      
 
Domain Number 4 Region: 442-509
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.57e-16
Family SAM (sterile alpha motif) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014857   Gene: ENSSHAG00000012679   Transcript: ENSSHAT00000014982
Sequence length 527
Comment pep:novel scaffold:DEVIL7.0:GL841311.1:1080559:1385560:-1 gene:ENSSHAG00000012679 transcript:ENSSHAT00000014982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLEGIDPQDPSKFFVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKH
ELHVPKGYRKDKVTCMDNLKTSKFQNAPKKLFLKRSIIGTPGEEFQVGMKLEAVDRKNPS
LVCVATIADIVGDRLLVHFDNWDDSYDYWCDIYSPFIQPVGWCQKNARTLIAPQGHPDPE
NFSWTDYLEATQSSAVPVKAFKMRKPHGFLVNMKLEAVDKRNPSLIRVATVIDIEDQRIK
VHFDGWSHKYDYWVDVDSPDIHPIGWCNMTGHPLEVPYREKDEKIAPGQAVCPTRGCRGV
GHIKGPSYMGHHSAYGCPYSDINLKKEAMFHHRLEKETQANFMADSSHPKLKGLCSVNFN
GKHEKLNSKLRLVQQAKCLKIKGKEDIDLDNLFREYSSESKQQALHQSVFLSAMSTHPSR
DLPLCREQHCKLLPGVADIQASEVAKWTVDEVANFVQSLPGCEDHSRYFKKEQIDGKAFL
LLTQTDIVKVMRIKLGPALKIFNSILMFRNAQDLGDTDSASSKVIRE
Download sequence
Identical sequences G3WHF2
ENSSHAP00000014857 ENSSHAP00000014857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]