SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014929 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014929
Domain Number 1 Region: 188-387
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.52e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.055
Further Details:      
 
Domain Number 2 Region: 72-160
Classification Level Classification E-value
Superfamily WWE domain 4.19e-16
Family WWE domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014929   Gene: ENSSHAG00000012738   Transcript: ENSSHAT00000015054
Sequence length 388
Comment pep:novel scaffold:DEVIL7.0:GL861616.1:1092621:1123713:1 gene:ENSSHAG00000012738 transcript:ENSSHAT00000015054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRRRGVGRGKGREPERERRHHTSLLQAAGSKRPRSERGEAPSTHHPGALRPGTAMFHR
TTEEFCSKPNTNGMNEMDTSDTQWGWFYLAECGKWHMFQPDTNIQCSVSSEDIEKSFKEN
PIGSISFTTSKYSYKLDFAVMKQMNLTTGKQRSIKRAPFSITAFSYICENEAIPVPSHWE
NVNTEEPYQLIPLHKQTNEYNEVANLFGKTVDSNRIKRIQRIQNLDLWEFFCRKKAQLKK
KRGVPKINEQMLFHGTSSEFVEAICIHNFDWRINGIHAAVFGKGTYFARDAAYSSRFCKD
DMKHGSTFQIHGVNLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSFVNLYDS
CVDNTWNPKIFVVFDANQIYPEYLIEFH
Download sequence
Identical sequences G3WHM4
ENSSHAP00000014929 ENSSHAP00000014929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]