SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015777 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015777
Domain Number 1 Region: 279-402
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.77e-27
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 
Domain Number 2 Region: 493-567
Classification Level Classification E-value
Superfamily PX domain 0.0000111
Family PX domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015777   Gene: ENSSHAG00000013443   Transcript: ENSSHAT00000015906
Sequence length 577
Comment pep:novel scaffold:DEVIL7.0:GL864788.1:1235533:1417624:-1 gene:ENSSHAG00000013443 transcript:ENSSHAT00000015906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLSEDFWEVAKQLRHRLSHVDVVKVVC
SDVVKTLLTHFCDLKAAQARQEEQPRPFLLHACLRNSDEEVRFLQTCSRVLVFCLLPSKD
VQSLSLRIVLAEILTTKVLQPVVELLSDPDYINQMLLAQLEYREQVNEHHKKAYTYAPSY
EEFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNM
KRYINQLTVAKKQCEKRIRLLGGPAYDQQEDGVSDEGEGPQSQKILQFEDILANPCYREH
FRIYMERMDKRALISFWESVEYLKNANKNEIPQLVGEIYQNFFVESREISVEKSLYKEIQ
QSLVGNKGIEVFYKIQSDVYESLKDRYYPSFIVSDLYERLIKKEEEKSVSQLISDKDEAS
QGGEVGEETIEEANDRINEQASYAVNKLRELNEKLDYKKQALHSIQNAPKPDRKIVSKLK
EEIILMEKERNDLQLHIARTDWWCENLGMWKAFINSGEVLEENGEQMPCYFVMVSLQEVG
GVETKNWTVPRKLSEFQNLHRKLSEVWILGELWVLEC
Download sequence
Identical sequences G3WK22
ENSSHAP00000015777 XP_012407523.1.9362 ENSSHAP00000015777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]