SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015917 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015917
Domain Number 1 Region: 421-559
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-45
Family Nuclear receptor ligand-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 131-220
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015917   Gene: ENSSHAG00000013561   Transcript: ENSSHAT00000016047
Sequence length 598
Comment pep:novel scaffold:DEVIL7.0:GL856827.1:1263072:1269656:1 gene:ENSSHAG00000013561 transcript:ENSSHAT00000016047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTLDSNNNTGGVITYIGSNGSSPSRTSPVSLCSESSNGSFQSLTHAFPTYFPPSPTGS
LTQDPGRPFGSAPPGLREDLSPSSSSSSSSSSSASFYNGSSPGGLQVAMEDSSRVSPSKS
TSSITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNESCSII
RINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSTQCPPE
ASPARIPAAGPLGSSPPPVPAPSPLVGFSQFPQQLTPPRSPSPEAKVEDVISQVARAHRE
IFTYAHDKLGTAPNGMNANQTPSGPPASTPPRWESHCCPPVPPDDNNSAATQRHNEARNG
LRPAASSYPPPWPATAPHHGCHQHNGNGHRLCPTHMYQGPEADASPGCPWQDRSKNILLA
CPMNMYPHGRSGRSVQEIWEDFSMSFTPAVREVVEFAKHIPGFCDLSQHDQVTLLKAGTF
EVLMVRFASLFNVKEQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEEL
GLFTAVVLVSAGRPRLRPQGLWGVGPRVPGGPPKDSGYQAAPHTPAPWPRGHQRRRVP
Download sequence
Identical sequences G3WKG2
ENSSHAP00000015917 ENSSHAP00000015917 XP_003768345.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]