SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015972 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015972
Domain Number 1 Region: 159-403
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-70
Family Nuclear receptor ligand-binding domain 0.000000000533
Further Details:      
 
Domain Number 2 Region: 50-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.03e-28
Family Nuclear receptor 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015972   Gene: ENSSHAG00000013598   Transcript: ENSSHAT00000016103
Sequence length 408
Comment pep:novel scaffold:DEVIL7.0:GL856827.1:1271720:1283217:-1 gene:ENSSHAG00000013598 transcript:ENSSHAT00000016103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKLDCGSDPEENRSLDGKRKRKTSQCSLKTSMSGYIPSYLDKDEQCVVCGDKATG
YHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDGCCIIDKITRNQCQLCRFKKCISVGMAM
DLVLDDSKRVAKRKLIEENRERRRKEEMIRSLQQRPEPSPEEWDLIHLVTEAHRSTNAQG
SHWKQKRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSEL
PCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDL
GKSLSAFNLDDTEVALLQAVLLMSSDRSGLLCVDKIEKCQEAYLLAFEHYINYRKHNIPH
FWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV
Download sequence
Identical sequences E2FHQ7 G3WKL7
XP_003768307.1.9362 XP_020852957.1.61212 ENSSHAP00000015972 ENSSHAP00000015972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]