SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016562 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016562
Domain Number 1 Region: 191-391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-51
Family DBL homology domain (DH-domain) 0.00000036
Further Details:      
 
Domain Number 2 Region: 2-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-39
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 
Domain Number 3 Region: 378-540
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 636-765
Classification Level Classification E-value
Superfamily SH2 domain 3.18e-27
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 5 Region: 781-844
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00076
Further Details:      
 
Domain Number 6 Region: 582-664
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000462
Family SH3-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016562   Gene: ENSSHAG00000014087   Transcript: ENSSHAT00000016701
Sequence length 846
Comment pep:novel scaffold:DEVIL7.0:GL856988.1:1392000:1864493:-1 gene:ENSSHAG00000014087 transcript:ENSSHAT00000016701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWRQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLKGHSINLKEI
NLRPQMSQFLCLKNIRTFLAACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEEIYKSLPDLIDETRADDEEDLYDCVYGEDEGGEVYEDLMKAE
EAQQPKCLENDIRSCCLAEIKQTEEKYTETLESIEKYFMTPLKRFLTATEFDTVFINIPE
LVKVHRSLTQEINDSIANKNDQNLYQIFINYKERLVIYGQYCSGVESAISGLDFISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPLEKANLKQALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLVFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRLDNCGRVNSGEQGKLKPEKPPNGLRRLPRQMDPGLPKMQVIK
NYTGNPQPPLQEGPPLHIQLGDTVELLRGDAHSLFWQGRNLASGEIGFFPSEAVKPCPCV
PKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKI
LTRDGFFHIAENRRFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPENSAGQRGNRAS
SNLLSPKVLGIAIARYDFCARDMRELSLSKGDVVKIYTKMSVNGWWRGEANGRVGWFPST
YVEEDE
Download sequence
Identical sequences G3WMA7
ENSSHAP00000016562 ENSSHAP00000016562 XP_003769758.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]