SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016740 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016740
Domain Number 1 Region: 463-561
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.9e-39
Family MBT repeat 0.0000882
Further Details:      
 
Domain Number 2 Region: 383-503
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.17e-33
Family MBT repeat 0.001
Further Details:      
 
Domain Number 3 Region: 164-270
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.76e-28
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 254-352
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.46e-24
Family MBT repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016740   Gene: ENSSHAG00000014242   Transcript: ENSSHAT00000016882
Sequence length 628
Comment pep:novel scaffold:DEVIL7.0:GL856819.1:1426219:1487914:1 gene:ENSSHAG00000014242 transcript:ENSSHAT00000016882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDGYDSCSEDTSSSSSSDESEEEVAPLPSSLPIIKNNGQVYTYPDGKSGMATCEMCGMV
GVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYA
QYQATLQSQAKTKSAVSLEGFSWGNYINSNSFIAAPVTCFKHAPMGTCWGDISENVRVEV
PNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFESDSSLDFWCNICGSDIHPVGWCAASGK
PLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPSMRVEVVDKTHLC
RTRVAIVESVIGGRLRLVYEESEDKSDDFWCHMYSPLIHHIGWSRSIGHRFKRSDITKKQ
DGHFDTPPHLFAKVKEVDQSGEWYKEGMKLEAIDPLNLSAICVATIRKVLADGFLMIGID
GSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPV
KLFNKDVPNHGFRVGMKLEAVDLMEPRLVCVATVTRIIHRLLRIHFDGWEEEYDQWVDCE
SPDLYPVGWCQLTGYQLQPPAPQTSRESQSGSSKQKKKAKSQQYKGHKKMTPLQLKEELL
DGEEYSFLQGASDQESNGSASYYIKQEP
Download sequence
Identical sequences G3WMT5
ENSSHAP00000016740 ENSSHAP00000016740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]