SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018046 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018046
Domain Number 1 Region: 839-891
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 2 Region: 900-950
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000046
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 3 Region: 325-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 4 Region: 793-841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 261-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 6 Region: 948-999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 745-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 413-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 10 Region: 1057-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 1105-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 12 Region: 1000-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.0023
Further Details:      
 
Domain Number 13 Region: 449-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018046   Gene: ENSSHAG00000015322   Transcript: ENSSHAT00000018195
Sequence length 1760
Comment pep:novel scaffold:DEVIL7.0:GL841583.1:1756362:1806152:-1 gene:ENSSHAG00000015322 transcript:ENSSHAT00000018195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLWSLVQIPSACAHEIPDLLPPPGCSGGSCYPPTGNLVVGRSQSLHASSTCGLRGPEPY
CIVSHLQDSEKCFFCDSRGQGGHRIKNVISLSGPDGERTWWQAESGVENVSIQLDLEGEF
YFTHLIMTFKTFRPAGLLIERSADGGRSWRVYRYFAHNCSGLFPGIPLTPGRKVSDLVCD
QRYSNIEPSSQGEVIFKVLDPAIPVEDPYSPEIQELLRVTNLRVNFSKLHTLGDGPLGGW
GHRHGPHYYYALYELVVRGSCLCHGHASECAPAPGAPPSVEGMVHGLCVCQHQTAGPHCE
RCQDLFHDQPWRPAEPGNAHACRECECHQHARSCHFDMAVFVASGNVSGGVCDACQHHTA
GRHCEICRPFYHRDPREDPRSPYTCKPCDCDPSGTLDGGLCDTHTDEVIGMLRSGQCRCK
EHVAGPRCQRCRDGYFGLSAADPQGCQRCRGDPRGPVPGGPPCDAGSGACFCKRLVTGRH
CERCLADHWGLSHDLLGCRPCDCDVGGALEPRCAEDSGQCRCRRHMFGRRCDQVQPGYFL
PFLDHLTFEAEAARGQALDIIERMAHPGMAASWTGVGFVRLREGQTLEFVVATVSQAMDY
ELLLRYEPQVPEQWAEVTLTVQRPGPISPSSPCGTTVPEDDHFRGMLQPGTRYVLLPSPV
CLEPGLSYTIRLELSRAGGDVRPGAPPPGLLFDSVSSQREGKVAAWVPGGWPPGWPGPGE
CLGRKSGPEGRAGMQPPLSAFSSACQCDPQGSLSSECQAHGGQCPCKPHVTGRRCHPCAP
GTFGFGTSGCRACQCSPEGSLSSLCHEASGQCPCRPGAFGPRCDRCQPGQWGFPSCRPCH
CNGHADDCDPRTGSCQSCRDHTAGDHCERCMAGFYGNPVLASGGHCRPCPCPEGPGGQRH
FATSCHQDRHSQQVICHCQPGYTGPRCEECAPGHFGDPLRPGGRCQPCECSSNIDPMDPE
ACDRQTGQCLRCLHNSEGPRCAHCRLGYYGQAAHQSCRRCTCNFLGTERSQCPSQDKCRC
DPGSGQCPCLPNIQGQSCDRCAPNFWNLASGQGCQPCSCHPSHATSPSCNEFTGQCHCRA
GFGGRTCTECQENHWGDPGLQCRACDCDSRGIETPQCHHATGHCVCRPGVAGVRCDQCAR
GFSGVFPACQPCHACFGDWDRIVQGLASRTRALEQRARELHQLGALGAFEKNFRLLGEKL
GTVQGIVNARNATAAATLQLMAITEDLRHDIEEATGQLTKLEGELTEAQDENFNANHALS
GLERDGRALNLTLRQLGQHLDVLKHSNFLGAYDSIRQSHAQSSEAEHRANRSALAVPGPV
SDSAATRRRAEGLMGSQRDSFDRRNVANRRALGELAAKANSLSLTGINELVCGAPGDAPC
ATSPCGGAGCRDEDGQRRCGGLNCQGAAATADNALGRARHTQEELRRTLGDADGLVGKVA
EARLQAGVARQRAQAALEKANETRDRVERANQELRELIQNVKDFLSQEGADPGSIEAVAT
HVLELSIPASPAQIHHLANEIAERVRSLGDVDTILQRTAGDVRQAEQLLQDAQQARTRAQ
SEKQKAEMVQDALEEARRAQGAAKGAIRGAAADTEGTEQTLGRVREKTAGAERDLSMATE
RTERLDAQLDALKLKRAGNSLEATRAEETANSAQGRAQEAEQLLKGQLGDRYQTVRDLAD
RKAQGVLQAKERAERLRDEARGLLQDAQDKLRRLHELEGTYEVNERALEGKAAQLDGLEA
KMKDVLQSINQQIQIYNTCQ
Download sequence
Identical sequences G3WRJ1
ENSSHAP00000018046 ENSSHAP00000018046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]