SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018100 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018100
Domain Number 1 Region: 193-461
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-85
Family Nuclear receptor ligand-binding domain 0.00000000338
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.56e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018100   Gene: ENSSHAG00000015367   Transcript: ENSSHAT00000018249
Sequence length 467
Comment pep:novel scaffold:DEVIL7.0:GL856749.1:1767787:1821407:-1 gene:ENSSHAG00000015367 transcript:ENSSHAT00000018249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTFSLSLIVKTILLISGSLSHTNSTSMSPSPALATGKSPDSHSNYIEAPVSVPRTLASPL
NAIASPLNALGSSYRVITSAIGPHSLSLATSPGVNMVGPPSSQLNVMNNVRSSDDVKPLP
GIQGMGTMSYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCR
DNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERSENEVESTSSGHEDMPV
ERILEAELAVEPKTESYGNTNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLE
DQVILLRAGWNELLIASFSHRSVTVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVS
KMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVEALREKVYATLEAYTKQKYPDQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences G3WRP5
ENSSHAP00000018100 ENSSHAP00000018100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]